KEGG   Desulfobacterium autotrophicum: HRM2_47970Help
Entry
HRM2_47970        CDS       T00861                                 

Definition
(GenBank) hypothetical protein
Organism
dat  Desulfobacterium autotrophicum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rrf2 Cdc6_C
Motif
Other DBs
NCBI-ProteinID: ACN17846
UniProt: C0QHI7
LinkDB All DBs
Position
5420197..5420748
Genome map
AA seq 183 aa AA seqDB search
MVSSTIVTEVLASLTRVPKSRIVGYVAELRKAGIIDTKGRGRGGAEMEKEDIRSIVFAVL
GAEMPKDAPEAVTRLMSLETKDGFTLGDAFMKYFHRMGVEDSEDRRPESITVNRSVPEAE
ITFRLYQDDLPTEKHITLFFQDQNFDYEQRGGFKIEATISNGVIQVLLNDLYHYEQMKEI
LKK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcagcacaatagtaactgaagttttggcaagtttaaccagggttcctaaaagc
cggattgttgggtatgtggcagaattacggaaagccgggattattgacacaaaggggcgg
ggccgtggcggggccgagatggagaaagaagacattcgaagtatcgttttcgccgtgctc
ggggccgagatgccgaaagatgcaccagaagcggtaacccggttaatgagtttggagaca
aaagacggctttacccttggggatgctttcatgaaatactttcatcgaatgggggtagag
gacagcgaagacaggaggccagaatcaataacggttaaccggtctgttcctgaggcagaa
atcactttccgactttatcaagacgatctgcccacagaaaaacatatcactttgtttttt
caagatcagaattttgattatgaacaacgtggtgggttcaagatcgaggctacgatttct
aatggtgtgattcaggtcttgcttaacgatctttaccattatgagcagatgaaagagatt
ttgaagaaataa

DBGET integrated database retrieval system