KEGG   Dermacoccus abyssi: FV141_00460Help
Entry
FV141_00460       CDS       T06197                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
day  Dermacoccus abyssi
Brite
KEGG Orthology (KO) [BR:day00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FV141_00460 (ahpF)
Enzymes [BR:day01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FV141_00460 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_2 Glutaredoxin DAO K_oxygenase FAD_binding_3 FMO-like Thi4 NAD_binding_9 Thioredoxin_4 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: QEH92175
LinkDB All DBs
Position
88920..90470
Genome map
AA seq 516 aa AA seqDB search
MAVLDQNMTAQLQQLLGNLREPVELRASLDDSDKSKQTEELLKEIEALHDLVSYSRTDEN
ERRPSFEIARRDTDVGVHFAGLPLGHEFTSLVLALLQVGGHPVKISDEQAQQIRDIEGEF
RFETYMSLSCQNCPDVVQALNAMSVINPNIHHIAIEGGAFQHEIEERDIKAVPTVYLNGD
VFGQGRMTIEDFISKLDTGADAKAAEKLSAKDAFDVLVVGGGPAGVAASVYTARKGISTG
LVADRIGGQVLDTMAIENFISMPYTEGPKLAAALDQHLHEYEIDVMKGQSVASIEDDGDL
KKVTTETGATLRAKQLILATGARWRRMNVPGEEEYRNKGVTFCPHCDGPLFKGKKVAVIG
GGNSGVEAAIDLAGVVGHVTVLEFLDTMRADEVLQRKLKSLPNVDIVMSAATTEVLGDGK
AVTGLEYTDRESGETKKLDVEGVFVQIGLLPNTEFLDGVVELNERKEIVVDARGGTSDPA
IFAAGDATTEPYKQIVVAEGSGATAALGAFDASIRV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggccgttctcgaccagaacatgaccgcccagctccagcagctgctcggcaaccttcgc
gagcccgtcgaactgcgcgccagcctcgacgactccgacaagtccaagcagaccgaagag
ctcctcaaggagatcgaggccctccacgacctcgtctcctactcgcgcaccgacgagaac
gagcgccgaccctccttcgagatcgcgcgccgcgacaccgacgtgggcgtccacttcgcg
ggcctgccgctcggccacgagttcacctcgctcgtgctcgccctcctccaggtcggcggc
caccccgtcaagatcagcgacgagcaggcccagcagatccgcgacatcgaaggcgagttc
cgcttcgagacgtacatgtcgctctcctgccagaactgccccgacgtcgtgcaggcgctc
aacgccatgagcgtcatcaacccgaacatccaccacatcgccatcgagggcggcgccttc
cagcacgagatcgaagagcgcgacatcaaggccgtgccgacggtctacctcaacggcgac
gtgttcggtcagggccgcatgacgatcgaggacttcatctcgaagctcgacaccggcgcc
gacgccaaggccgccgagaagctcagcgccaaggacgcgttcgacgtcctcgtcgtcggc
ggtggccccgcaggtgtggccgcgtccgtgtacacggcgcgcaagggcatctccaccggc
ctcgtcgccgaccgcatcggcggccaggtgctcgacaccatggccatcgagaacttcatc
tcgatgccgtacaccgagggtcccaagctcgccgcggcgctcgaccagcacctgcacgag
tacgagatcgacgtcatgaagggtcagagcgtcgccagcatcgaggacgacggcgacctc
aagaaggtgacgaccgaaaccggtgccaccctgcgcgccaagcagctcatcctcgccacc
ggcgcccgctggcgccgcatgaacgtgcccggcgaagaggagtaccgcaacaagggcgtc
acgttctgcccgcactgcgacggccccctgttcaagggcaagaaggtcgccgtcatcggc
ggcggtaactccggcgtcgaggccgccatcgacctcgccggtgtcgtcggccatgtcacc
gtgctcgagttcctcgacaccatgcgcgccgacgaggtgctgcagcgcaagctgaagtcg
ctgccgaacgtcgacatcgtcatgtccgccgcgacgaccgaggttctcggcgacggcaag
gccgtcaccggcctcgagtacaccgaccgcgagagcggggagacgaagaagctcgacgtc
gaaggcgtcttcgtccagatcggtctcctgccgaacaccgagttcctcgacggggtcgtc
gagctcaacgagcgcaaggagatcgtcgtcgacgcccgcggcggcacctccgacccggcg
atcttcgccgccggcgacgcgacgaccgagccctacaagcagatcgtcgtcgctgaaggt
tccggcgccacggccgcgctcggcgcgttcgacgcgagcatccgcgtctga

DBGET integrated database retrieval system