KEGG   Drosophila arizonae: 108610471
Entry
108610471         CDS       T05886                                 

Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
daz  Drosophila arizonae
Pathway
daz00230  Purine metabolism
daz01100  Metabolic pathways
daz04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:daz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108610471
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    108610471
Enzymes [BR:daz01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108610471
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNF-1_N
Other DBs
NCBI-GeneID: 108610471
NCBI-ProteinID: XP_017858082
LinkDB
Position
3
AA seq 1170 aa
MPEEKASNLENGQTTAASTPSKTKRQRTPTRRRPPNEGDVVAGGVGITGGGVVILPQHVL
NELYHNYSIKQRRSGLKWFLFAAVLFNLWTICIPWEQAFLTRVVNCSMLLAYLALTALLH
IGRQSEQPALRRLHHSLLTVVPRALWFLSMLHFAAYVMLQASFSPRDVLGWAILLNFLIY
VTLPLPLIFLGLVIGFCTYFNCLSLPVGFSRPDPLISDQAAANAVLIATAALIGLLYYFM
GEAKQKRAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSSSSEAFKKI
YMSRHENVSILYADIVGFTAISSTYSAQDLVKMLNELFARFDRLAEKYQQLRIKILGDCY
YCISGAPDERPDHAVLCVHMGLSMVKAIKYVQQKANSPVDMRVGIHTGAVLAGILGQRQW
QFDVYSKDVELANKMESSGKAGRVHISDKTLAFLNGEFEVEPAFGEKREELLRIAGLKTY
FITKVVKPFASPCGKKINESKSENTNHSPDSNPSSNSSNESNECAGDDNDATVDDEELLA
QSVVINGHNPTAAEDEEEQIKLENFKQRLKDELVTRDGHENLTKDTNIFLRFKNPQLEQA
YAVYREPYSSLPLLAALLVQCIDVLYSYLVLPRSTLHFINIAAPLVPIAMLVAISIAESF
SGMLPKFFVDVSKRFNDITFVRELAAIIIALTIGLSNVIDMFFFVTFVRTEHIVSESEFN
ATGGLEEVATAEHLLPESFVEQMREAVPTERVLYPSYLSNFSVLILIAIAVIAQLTHLTK
ILLLLSIAALHCYFNVCIMQDLYILEDDLAHQPLISTRYCASGLLLVAALSLSFLARHMD
HEDRVIFKWKTEVAEQKETANDMRQRNEALVYNVLPVHVAEHFMKNTKRSHDDLYSQSYA
EVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDIIKIKTIGST
YMAASGINLQRNLRTDAPITERWSHLAVLVEFALELKHALQGINEQSFNHFVLKMGINHG
PITAGVIGARKPHYDIWGNTVNVASRMESTGKAGAVQVTEETCNILQQFGYTFQQRGLVA
VKGKGQLMTYYLQGKTESSAAEAKAAVELHEKETVTTAAPVSVSLECSTELEADIKTPLL
KLKAQDAATEAAAESCLGNGTVGESQSLLE
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgccggaagagaaggcatccaatctcgagaatggccaaacaacggcagcatccacaccc
agcaaaaccaaacgccaaaggacaccaacacgtcgacgtccgccaaacgaaggcgatgtc
gtcgctgggggcgtgggcattaccggcggtggtgtggtcatcctgccccagcacgtgctc
aacgaactctatcacaactattccattaagcagcgacgcagcggccttaagtggttcctg
tttgcggccgtgctctttaatctctggacgatttgcataccctgggagcaggcgtttctc
acaagagtggtcaattgcagcatgctgttggcctatttggcgctgacggctctgctgcac
attggacgccagtcggagcagcctgccctgagacgcttgcatcactcgctgttgacagtt
gtgccgcgagccttgtggttcctctcgatgcttcatttcgccgcctatgtgatgctgcag
gctagcttctcgccgcgagatgtgcttggctgggcgattctcttgaacttcctaatatat
gtgacattgccattgccgttgattttcctgggcctggtaattggcttttgcacgtacttc
aattgcttgagtctgcccgttggcttctcacgtccagatcctttaatctcagatcaggcg
gcggctaatgccgttttaatagccaccgcagcgttaattggactattatattactttatg
ggcgaggcgaagcagaagcgcgccttcctggaggccaaaaagagtctggaggtcaagatg
gtcatagaggagcagtcggcagaacaggaacgtttgctgctatccgtgctgcccaagcat
gtggctatcaagatgcgcgaagacttgggctcatctagttcagaggccttcaaaaagatc
tatatgagtcgacatgagaatgtgagcatactgtatgcggatattgttggctttaccgcc
atctcctcgacgtatagcgcccaagatctggtaaaaatgctaaacgagctcttcgcacgc
ttcgataggctcgccgagaagtaccaacaactgcgcattaaaattctcggtgattgctat
tattgcattagtggagcgcccgacgagcggccggatcatgccgtgctctgtgttcacatg
ggactttccatggttaaggccatcaaatatgtgcagcaaaaggcaaactcacctgttgat
atgcgtgtgggcatacacacaggtgctgtcctggccgggatactgggccagcgtcaatgg
cagtttgacgtttactccaaggacgttgagctggccaataaaatggagtccagtggcaaa
gccggacgtgtacacatttccgacaaaacattggcctttctcaatggcgaattcgaggtg
gagccggcctttggcgagaagcgggaggagctgttgcgcatagctggcctgaagacatat
ttcattacgaaagtggttaaaccgttcgcctcgccctgcggcaagaaaatcaacgaatcg
aagtcagagaataccaaccatagccccgactcgaatcccagcagcaacagcagcaatgag
agcaacgaatgtgctggcgatgacaacgatgccacagtcgatgatgaggagctcttagca
caaagtgtcgtcatcaatggacacaatcccacagccgccgaggatgaggaggagcaaata
aagctggagaatttcaagcaacgtttaaaagatgaactggtcacacgcgacgggcacgaa
aatctcaccaaggacacgaacatctttttacgcttcaagaatccgcaactggagcaggct
tatgccgtctatcgggagccatacagctcgctgcccttgctggccgccctgctggtgcag
tgcatcgatgttttatattcatacttggtgttgccgcgctcaacactgcatttcattaac
attgccgcgccgctggtgcccatcgccatgctggtggcgattagcattgccgaaagcttt
agcggcatgctgcccaagttctttgtggatgtgagcaagcgtttcaatgacattaccttc
gttcgggagctggcggccataattatagcacttaccattggccttagcaatgtcatcgac
atgtttttctttgtcaccttcgtgcgcaccgagcacattgttagcgagagtgaattcaat
gccacgggcggcttagaggaggtggccaccgccgagcacctgctgcctgaatcgtttgtg
gaacagatgcgtgaagcggtgcccaccgagcgtgtcctatatccgtcctatttgagcaac
ttcagtgtcctcatacttatcgccattgctgtaattgcacagctcacgcacttgaccaaa
atcctgttgctcctgtccattgcagccctgcattgttatttcaatgtgtgcattatgcag
gatttgtacattctggaggatgatctggcacaccagcctcttatatcaacgcgttattgt
gcctcaggtctgctactagtggcggcattgtcactcagctttttggcaagacatatggac
cacgaggatcgtgttatattcaaatggaaaactgaggtggccgagcagaaggaaaccgcc
aacgatatgcgtcagcgcaacgaggctttggtctataatgtgctgcccgtgcatgtggcc
gagcattttatgaagaatacaaagcgctcccacgacgatctctactcgcagagctatgcc
gaggtgggcgtgctcttcgccagcatgccaaacttttcagatttctattcggaggagacc
gttaacaatcagggcctggaatgcttgcgttttctgaatgaggtcatttccgatttcgat
gcgctattggaactgccacagtttcaggacatcattaagataaagacaattggatcaact
tatatggcagccagtggcattaatttgcagcgcaatttacgcactgatgcgcctattacc
gagcgctggtcccacttggcggttctggtggaattcgccctggagctgaagcatgcgctg
cagggcatcaatgagcaatcattcaatcattttgtactcaaaatgggcatcaatcatgga
ccgataacggcgggcgtgattggcgcccggaagccacactacgatatctgggggaatacg
gtgaatgtggcctcgagaatggagagcaccggcaaagcgggtgccgtgcaggtcaccgag
gagacctgtaacatattgcagcaattcggatatacgtttcagcagcggggcctggtggct
gtaaagggcaagggacagctgatgacctattacttgcagggcaaaactgagagcagcgct
gcggaggcaaaggcagccgttgagctgcatgagaaagagacggtgaccacggcagctcca
gtgtcagttagtttggagtgcagcactgagctggaagcggacataaagacaccactgctg
aagctcaaggcacaggatgcagcaacggaagccgcggcagaatcatgtctgggcaacgga
accgttggggaatctcaatccctgttggagtga

DBGET integrated database retrieval system