KEGG   Drosophila arizonae: 108615467
Entry
108615467         CDS       T05886                                 

Definition
(RefSeq) caspase-1
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
daz  Drosophila arizonae
Pathway
daz04214  Apoptosis - fly
daz04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:daz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108615467
   04215 Apoptosis - multiple species
    108615467
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:daz01002]
    108615467
Enzymes [BR:daz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     108615467
Peptidases and inhibitors [BR:daz01002]
 Cysteine peptidases
  Family C14: caspase family
   108615467
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 108615467
NCBI-ProteinID: XP_017865459
LinkDB
Position
5
AA seq 318 aa
MTDEWKIRSFGSLDLDSGKINNNADTIDAKGEASTNSVRSGGAANAVAAPINKYVARMTT
DRYAKEYNMNHKHRGQALIFNHEHFTIPYLSTRRGTNVDSEQLTKALERLGFEVSVHKDC
ILSEILNVVSKAAAKDHTDNDCIVIAVMSHGEHGHLYAKDVQYRLDSIWTYFTANNCPTL
AGKPKLFFIQACQGDKLDPGTTMVKETETDGDSSTSYKIPTHADFLFSYSTIPGYFSWRN
TDNGSWYIQSLIKELNENGKEYNMLTLLTFVSQRVAVDYESNVPSNPLMDRQKQIPCVTS
MLTRILRFNDKPPYSQAG
NT seq 957 nt   +upstreamnt  +downstreamnt
atgacggacgaatggaaaattagatcctttggctctctcgaccttgacagcggcaaaata
aacaacaatgctgataccatcgacgcaaaaggagaagccagcacaaattctgtgcgaagc
ggtggtgcagccaatgccgtcgcagccccaataaataaatatgtcgctcgtatgaccacc
gaccgatacgccaaggaatataatatgaatcataagcaccggggacaggccctcatcttc
aatcacgaacatttcactataccctatctgtcaacgcgtcgcggcaccaatgtggacagc
gaacagctaaccaaggccttggaacgtctaggtttcgaggtgagtgtccacaaggattgc
atcctgagcgagattctcaatgttgtgagcaaggccgctgcaaaggatcacactgacaac
gattgcatagtgattgcggtgatgtcccatggcgagcacggtcacctctatgccaaagat
gtgcagtacaggctggacagcatctggacctattttaccgccaacaattgccccacgcta
gctggaaagccgaagttattcttcatacaggcctgtcagggtgataaactggatccgggc
acgaccatggtgaaggaaactgaaacggatggcgattcctcgacgagctacaaaatacct
acacatgccgactttctattctcatattcaacaataccaggatacttttcgtggcgcaac
actgataacggctcatggtacatacagtcgctcataaaggagctcaatgaaaatggcaag
gagtacaatatgctcacattgctgacttttgttagccaacgtgtggcggtggattacgaa
tcgaacgtgccatcgaatccgttgatggatcgtcagaagcaaattccatgtgtgacgtca
atgttgacgcgcattttgcgctttaatgacaaacccccttacagccaggccggctaa

DBGET integrated database retrieval system