KEGG   Desulfarculus baarsii: Deba_0429
Entry
Deba_0429         CDS       T01284                                 

Definition
(GenBank) hypothetical protein
Organism
dbr  Desulfarculus baarsii
SSDB
Motif
Pfam: Yip1
Other DBs
NCBI-ProteinID: ADK83803
UniProt: E1QE17
LinkDB
Position
complement(489014..489703)
AA seq 229 aa
MNDFEQPQPSSQPPPQPALPWEAPQRWLAGFYPTFWWIARYPSRTFSLPAAGGPLRPALF
VAVLALHLELISQALAWALTPGVGLAELPSIIAVGLMNGMVQGVGAAMLATPILSGLAHL
ALRAVGRARAPYVASYRALAYTAVTSVSVLAVMIVWHLARLAWGAESGDSLVGVVMGGLA
CSLVWSLYVGGVALDAAHHCGKVTAMAAQVAAALAMILFMFGIFGVGGA
NT seq 690 nt   +upstreamnt  +downstreamnt
gtgaacgacttcgagcagccccagccatcatcccagccaccgcctcagccagccctgccc
tgggaagcgccccaacgttggctggccggcttttaccccacgttctggtggatagcccgc
tatccctcgcgcactttttcgttgccggcggccggcgggccgctgcggccggcgctgttc
gtggccgtgctggccctgcatctggagctgatcagccaggccttggcctgggccctgacc
cctggcgtcggcctggccgagctgcccagcatcatcgccgtgggcctgatgaacggcatg
gtccagggcgtgggcgcggccatgctggccacgccgatcctcagcggcctggcccatctg
gcgctacgggccgtgggccgggccagggcgccctacgtggcctcctatcgggcgctggcc
tacaccgcggtgacttcggtctcggtgctggcggtgatgatcgtctggcatctggcccgc
ctggcctggggggccgaaagcggcgactcgttggtcggcgtggtcatgggcgggctggcc
tgctcgctggtctggagcctctacgtgggcggcgtggccctggacgcggcccaccactgc
ggcaaggtcacggccatggccgcccaggtcgccgcggcgttggccatgatcctgttcatg
ttcggcattttcggggtcggcggggcctga

DBGET integrated database retrieval system