Solidesulfovibrio carbinolicus: C3Y92_08650 Help Entry C3Y92_08650       CDS       T06503                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism dcb  Solidesulfovibrio carbinolicus Pathway dcb00020   Citrate cycle (TCA cycle) dcb01100   Metabolic pathways dcb01110   Biosynthesis of secondary metabolites dcb01120   Microbial metabolism in diverse environments dcb01200   Carbon metabolism dcb01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:dcb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     C3Y92_08650 Enzymes [BR:dcb01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      C3Y92_08650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_21 Fer4_9 Fer4_10 Fer4_4 Fer4_6 Fer4_16 Fer4_17 Fer4_8 Fer4_22 Fer4_13 Fer4_15 FeS Motif Other DBs NCBI-ProteinID:  QAZ67290 UniProt:  A0A4P6HMS7 LinkDB All DBs Position 1995705..1996031 Genome browser AA seq 108 aa AA seqDB search MIPTLFHRVTGHRKSESNMGRNRVVVYPDWCKGCGICAAFCPKKVFAVGQDGKARVVNEE ACVNCGFCEPHCPDFAVLVIPGETDQTPCPSETVKDPAEQPAAKEVKP NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgattccgacactttttcaccgcgtaaccggccaccgcaaaagcgagtcgaacatggga cgcaatcgtgtcgttgtctatccggactggtgcaagggctgcggcatatgcgccgcgttt tgccccaaaaaggtctttgccgtgggccaggacggcaaggcccgtgtcgtaaacgaggaa gcctgcgtcaactgcggtttttgcgagccgcattgcccggatttcgccgtcctggtcatc ccgggcgaaaccgaccagacgccgtgtccatcggaaacggtgaaggacccggccgaacaa cccgccgccaaggaggtcaagccgtga

DBGET integrated database retrieval system