KEGG   Dendrobium catenatum: 110104314Help
Entry
110104314         CDS       T05027                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dct  Dendrobium catenatum
Pathway
dct03030  DNA replication
dct03410  Base excision repair
dct03420  Nucleotide excision repair
dct03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dct00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110104314
   03410 Base excision repair
    110104314
   03420 Nucleotide excision repair
    110104314
   03430 Mismatch repair
    110104314
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dct03032]
    110104314
   03400 DNA repair and recombination proteins [BR:dct03400]
    110104314
Enzymes [BR:dct01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110104314
    6.5.1.6  DNA ligase (ATP or NAD+)
     110104314
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110104314
DNA replication proteins [BR:dct03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110104314
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110104314
DNA repair and recombination proteins [BR:dct03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110104314
   NER (nucleotide excision repair)
    Other NER factors
     110104314
   MMR (mismatch excision repair)
    Other MMR factors
     110104314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase TrmB
Motif
Other DBs
NCBI-GeneID: 110104314
NCBI-ProteinID: XP_028556618
LinkDB All DBs
Position
Unknown
AA seq 737 aa AA seqDB search
MHYMLFRVPTVLHPLRCSCLPPSPLSSFLKNPNKISLTSLLSSSQRCTMASGRTVADVLM
GASRAAAAKKNRQALSSQSENYSSPIKKHKVLEPPSATDEPKKLETTDILVELRKKGSDF
DPKAAASWKDGDPVPFIFLARALDLISNESGRIAITDIICNVFRTVMATTPNDLLPTVYL
SANRVAPPHEGIELGIGDASLIKALAEAYGRKEEHVNKQLQELGDLGLVAKASRSSQRVL
YKPQRLTITKVFDTFRAIAKESGKDSQDKKRSYIKGLLVAATDCEPLYIIRLLQSKMRIG
LAEKTVLVALGQASVYSEALKCATFKNYSQTLEEAAKIIKQVYSVLPDYGKIVPALLHVG
VLKLSEACNFSLGVPVGPMLAKPTKSVSEILDKFQGTEFTCEYKYDGERAQIHYMEDGSI
EVYSRNAERNTGKYPDVVSAVSRFKNPEVSSFVLDCEIVAFDREKQKILPFQVLLLIRGR
PRAVITKSPPPALLHEQLKVRREELYNSFAEVPGEFRFATTITSNDLEEIQKFLEKAVSS
SCEGLIIKTLDKDATYEPSKRSNNWLKLKKDYMDSVGDTLDLVPIAAFHGRGKRTGVYGS
FLLACYDEQNDEYQSICNIGTGFSELQLEERSKSLGSKVIPKPKPYYRVADSMNPDVWFE
PAEVWEVKAADLSISPVHRAASGIVDPNKGISLRFPRLQRVRDDKSPEQATTSEQVAEMY
RAQKINHMNNNEEEDDE
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcattacatgctctttagggtaccaactgtactccatccccttcgatgctcctgtctt
cctccttcgcctctttcttcatttctcaaaaaccctaataaaatctcactcacctctctc
ttgtcttcctcccagcgttgtacaatggcgtccggccgcacggtcgccgatgtcctcatg
ggcgcctctcgcgctgccgcagccaagaagaatcgccaggctttatcatcccaatccgag
aactattcttcccctatcaagaaacacaaagtcctagaacccccatctgccacggacgaa
ccaaagaagttggaaactaccgacatccttgtcgaacttaggaaaaagggctccgatttc
gaccctaaagccgccgcctcatggaaagatggcgacccggtaccgttcatcttcctcgcc
cgcgcactagacctcatctcgaacgagtcgggtaggatcgcaatcacggacatcatctgc
aatgtcttccggactgttatggctactactcctaacgaccttcttccgacggtttatttg
tcggctaatagggttgctcctccacatgagggcatcgagcttggtataggagatgcttcg
cttatcaaggctctcgccgaagcttatgggaggaaggaagagcatgtcaataagcagcta
caggaattaggtgacttgggtcttgtcgccaaggctagtaggtcttcacagagagttttg
tacaagcctcagcgtttgaccatcaccaaagtttttgatacatttcgcgccattgcaaag
gaatctggaaaggacagccaagacaagaaaagaagttacattaaaggtcttcttgtagct
gccactgattgtgaaccgttatacataattcgccttcttcagtccaaaatgagaataggc
ttggcggagaaaacagtgcttgtagctcttgggcaagcatctgtatattcagaagcactt
aagtgtgcaacttttaaaaattattctcagacattggaagaggctgcaaagatcattaaa
caagtatattctgttctgccggactacggtaaaattgtgcctgctcttcttcatgttggg
gtactgaaactttcagaggcatgcaatttctctttgggtgtgccagtgggacctatgctg
gctaaacctacaaaatcagtctctgagatcctagacaaatttcaaggaaccgagtttaca
tgtgaatataagtatgatggtgagcgggctcagatacattacatggaagatggttctata
gaggtatatagccgtaatgctgaacgaaatactggaaaataccctgatgtggtcagtgct
gtatcaagattcaagaacccagaagtaagctcttttgtgttggattgtgaaattgttgca
tttgatcgtgagaagcagaaaatcttacctttccaggtattgttactaattagagggagg
cctagagcagtaattaccaaatcccctccaccggccctcctccatgagcaactcaaagtt
cgcagggaggaactttacaattcttttgcggaagtaccaggagaatttcgttttgcaact
acaataacatctaatgatcttgaagaaatacagaagttcttagaaaaagctgtcagctcc
agctgtgaagggttgattatcaaaactttggacaaagatgcgacatatgagccttcgaaa
aggtcaaacaactggttaaaattaaaaaaagattatatggacagtgtaggagacacttta
gatctagttcccattgctgccttccacggtcgtggaaaacgcacaggtgtttatggttct
tttcttcttgcttgctatgatgaacaaaatgatgaatatcaaagcatatgtaacatcggt
actgggttttctgagttgcagcttgaagagaggtccaaaagtcttggaagtaaagttata
ccaaagccaaaaccatactatagagttgctgattcaatgaatcctgatgtctggttcgag
ccagcagaggtctgggaagtaaaggcagctgatttgagcattagtcctgttcatcgtgct
gcttctggcattgtggatccaaataagggtatttctcttcgatttcctcgcctacaacgt
gtccgagatgacaaaagcccagaacaagccacaacatctgaacaggttgctgagatgtat
cgcgcccaaaagatcaatcatatgaacaataatgaggaagaggatgatgaatga

DBGET integrated database retrieval system