KEGG   Dickeya paradisiaca: Dd703_3453Help
Entry
Dd703_3453        CDS       T00927                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dda  Dickeya paradisiaca
Brite
KEGG Orthology (KO) [BR:dda00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dd703_3453
Enzymes [BR:dda01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Dd703_3453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 HI0933_like NAD_binding_8 FAD_binding_3 DAO Glutaredoxin Thi4 AlaDh_PNT_C K_oxygenase NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ACS87213
UniProt: C6C3B5
LinkDB All DBs
Position
complement(4022458..4024026)
Genome map
AA seq 522 aa AA seqDB search
MLDNTMKIQLKAYLEKLTKPVELVATLDGSAKSSDVRGLLADIAGLSDKVSFFENNDLPV
RKPSFLVTNPGSASGPRFAGAPMGHEFTSLILALLQVGGHPSKEAQELLDQIRELDGKFH
FETYYSQTCHNCPDVVQALNLMSILNPNITHTAIDGGVFQDEIKDRNIMGVPTVFLNGDQ
FGQGRMTLGEIVAKLDTGAGDKLVEKLNNRPVYDVLIVGSGPAGAAAAVYAARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGAKLAMALKSHVDDYEVDVIDLQSAQRLIPASKPG
MPHQIETASGAVLKSRSIIIATGARWRSMNVPGEEQYRTRGVTFCPHCDGPLFKGKHVAV
VGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQAKLRSLPNVDVIVNAQTTEVIGD
GQKVTGLEYRDRVTSDTHKLALEGIFVQIGLLPNTHWLEGSVERNRIGEIIIDAKCETTV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTPTSA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaatactatgaaaatccagctgaaagcctatctggaaaaattaaccaaacct
gttgagttagtggcgacgctggatggttccgcaaagtcttcggacgtcagagggttgctg
gccgacatcgccgggttatccgataaagtcagtttctttgagaataacgatctgccggta
cgcaaaccgtcgtttctggtgacgaatccgggttccgccagcggcccgcgtttcgccggc
gccccgatggggcatgagttcacttcgttgatcctggccttgttgcaggtcggcggccat
ccgtcgaaagaggcgcaggaactgctggatcagatccgcgagctggatggcaaattccat
tttgaaacctattactcccagacctgccacaactgcccggatgtggtgcaggcgttgaac
ctgatgtccatcctgaacccgaacatcacgcataccgcgattgatggcggcgtattccag
gatgaaatcaaggatcgcaatatcatgggcgttcccaccgtattcctgaacggcgatcag
tttggacaagggcgcatgaccctcggcgagatcgtcgccaaactggataccggcgccggc
gacaagctggtggaaaaactgaataaccgaccggtatacgacgtgctgatcgtcggtagc
ggcccggccggcgcggcggcggcggtgtatgccgcccgcaaagggatccgtaccggtctg
atgggcgagcgcttcggcggccagattttggataccgtggacattgaaaactacatttcc
gtcccgaaaaccgaaggggccaaactggccatggcgctcaaaagccatgtagatgactat
gaagtagacgttatcgacctgcaaagcgcacagcgcctgattccggccagcaagccgggc
atgccgcaccagattgaaacggcatcgggcgccgtgctgaaatcgcgtagcatcatcatc
gcaaccggtgcgcgctggagaagtatgaacgtgccgggggaagagcagtaccgtacccgc
ggcgtcactttctgtccgcattgcgacggccccttgttcaagggcaagcatgtggcggtg
gtcggcggcggcaactccggggtggaggcggctatcgatctggcgggcgtggtgaaacac
gtgacgttgctggagttcgcgccggagctgaaggccgactcggtactgcaggccaaatta
cgcagcctgccgaacgtagatgtcattgtgaatgcccagaccaccgaagtgatcggtgac
ggccagaaggtgacgggcctggaataccgggatcgcgtcaccagcgatacccacaaactg
gcgctggaagggattttcgtgcagatcgggctgttgccaaacactcactggctggaaggg
tcggtggaacgtaaccgtatcggcgaaatcatcatcgacgctaagtgtgaaactaccgtc
aaaggggtgtttgccgccggagactgcaccacggtgccgtacaagcagatcattatcgcc
accggcgaaggtgctaaagcgtcgctcagcgcctttgattatctgatcagaaccccgaca
tcggcctga

DBGET integrated database retrieval system