KEGG   Dictyostelium discoideum (cellular slime mold): DDB_G0280199Help
Entry
DDB_G0280199      CDS       T00245                                 

Gene name
gadA
Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ddi  Dictyostelium discoideum (cellular slime mold)
Pathway
ddi00250  Alanine, aspartate and glutamate metabolism
ddi00410  beta-Alanine metabolism
ddi00430  Taurine and hypotaurine metabolism
ddi00650  Butanoate metabolism
ddi01100  Metabolic pathways
ddi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DDB_G0280199 (gadA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DDB_G0280199 (gadA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DDB_G0280199 (gadA)
   00430 Taurine and hypotaurine metabolism
    DDB_G0280199 (gadA)
Enzymes [BR:ddi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DDB_G0280199 (gadA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 8622433
NCBI-ProteinID: XP_641300
dictyBase: DDB_G0280199
UniProt: Q54VQ5
LinkDB All DBs
Position
3
AA seq 462 aa AA seqDB search
MSLHHVKTNKYKGFYDSYASPPATKEISKYSLKEESNKPEVIRDLIIDELLLDGNAKQNL
ATFCQTDLDKEIHVLMDKCIDKNMIDKDEYPQTAEIESRCVHILADLWNSPESSETIGCS
TTGSSEAAMLGGMALKWRWRENRKKQGKPFDKPNIVTGPVQICWHKFALYFDIELREVPM
EHDRYIMTPEEAIKRCDENTIGVIPTLGVTFTLQYEDVKGISEALDKFEKETGLDIPIHV
DAASGGFVAPFLQPEIVWDFRLPRVKSINGSGHKFGLSPLGVGWVVWRGKNDIHKDLVFD
VNYLGGNMPTFSLNFSRPGGQIVCQYYNFLRHGRSGYTAVHQACLDHGIFISKQVKKHGI
FDIVYDGTGALPGACWKLKKDAKVKFNLFDLSDRMRNRGWQIASYTLPNLPDIVVQRVLI
RHGFSHDMAMLLIEDFNRSIEYFDKHPMVQSISKDEGQSFHH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttcatcatgtcaaaacaaataaatataaaggtttttatgattcttatgcatca
ccacctgcaacaaaagaaatttcaaaatattctttaaaagaagagtcaaataaaccagaa
gttattagagatttaataattgatgaattattattagatggtaatgcaaaacaaaacttg
gccacattttgtcaaactgatcttgataaagagattcatgtattaatggataaatgtatt
gacaagaatatgattgacaaggatgaatatccacaaactgctgaaattgaaagtcgttgt
gttcatattttagcggatttgtggaattcaccagaaagttctgaaactattggttgttca
actactggatctagtgaagctgcaatgttgggtggaatggctttgaaatggagatggaga
gaaaatagaaagaaacaaggtaaaccatttgataaaccaaacattgtaactggtccagtt
caaatttgttggcataagtttgcactatactttgatattgaattaagagaagtaccaatg
gaacatgaccgttacataatgacaccagaggaagccataaaacgttgtgatgaaaatacc
attggtgtaattccaacattgggtgtaacatttacactacaatatgaagatgttaaagga
atttcagaagctttggataaatttgaaaaagaaaccggacttgatataccaattcatgtc
gatgcagcaagtggtggtttcgttgcaccctttcttcaaccagaaattgtttgggatttt
agactaccacgtgttaaatcaattaatggctctggtcataaatttggtctatctccattg
ggagttggctgggtcgtatggagaggtaaaaatgacattcacaaggatttggtattcgat
gtcaactatcttggtggcaatatgccaacattttcattgaatttctcacgtccaggtggt
caaatagtatgccagtactataactttttgcgccatggtcgtagtggatataccgcagtt
catcaagcttgtctagatcatggtattttcatttccaagcaagttaaaaaacacggtatt
tttgatattgtttatgatggtactggtgcacttccaggtgcatgttggaaattgaaaaaa
gatgcaaaagtaaaattcaatctctttgacctttcagatagaatgagaaatagaggttgg
caaattgcatcctatactctaccaaacttaccagatattgtagttcaaagagtattaatt
agacatggtttcagtcatgatatggcaatgctcttaattgaagatttcaatcgtagtatt
gaatattttgataaacatccaatggttcaaagtatttcaaaagatgaaggtcaatcattc
catcattaa

DBGET integrated database retrieval system