KEGG   Dokdonia donghaensis: I597_1195Help
Entry
I597_1195         CDS       T04309                                 

Gene name
pdhC
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ddo  Dokdonia donghaensis
Pathway
ddo00010  Glycolysis / Gluconeogenesis
ddo00020  Citrate cycle (TCA cycle)
ddo00620  Pyruvate metabolism
ddo01100  Metabolic pathways
ddo01110  Biosynthesis of secondary metabolites
ddo01120  Microbial metabolism in diverse environments
ddo01130  Biosynthesis of antibiotics
ddo01200  Carbon metabolism
Module
ddo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ddo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I597_1195 (pdhC)
   00020 Citrate cycle (TCA cycle)
    I597_1195 (pdhC)
   00620 Pyruvate metabolism
    I597_1195 (pdhC)
Enzymes [BR:ddo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     I597_1195 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 Cuticle_4
Motif
Other DBs
NCBI-ProteinID: ANH60113
UniProt: A0A0A2GYM0
LinkDB All DBs
Position
1369820..1371466
Genome map
AA seq 548 aa AA seqDB search
MAEVINMPRLSDTMEEGTVATWLKSVGDKVEEGDILAEIETDKATMEFESFNEGVLLHIG
IEEGQTAKVDTLLAIIGEEGEDISGLLTGDASAKEEETSTSDSSDSEDNAEATAEDDTQE
DTSSDVPEGVIVVTMPRLSDTMEEGTVATWLKSVGDMVEEGDILAEIETDKATMEFESFQ
SGTLLHIGINEGETAKVDALLAIIGPEGTDVSGVIKSGGAPAKSAPKKEEKKEEKKEAPK
ASKENTTSAPKAAAPAKATTTTSTNGGRIFVSPLAKKIAEEKGINLAQVKGTGENGRIVK
SDVENFTPSAGGSVQQFVATGEESFEEIENSQMRKAIARGLGKSKFTAPHYYLNVEFNME
NMMSFRKQFNTQPDTKVSFNDMIIKATSIALKQHPQVNSQWFDDKMRLNHHVHIGVAVAV
PDGLVVPVVEFANEKSLQQINAEVKTLAGKARDKKLTIPEMEGSTFTISNLGMFGITDFT
SIINQPNSAILSVGAIVEKPVVKNGQLAVGHTMKLTLACDHRTVDGATGAQFLQTLKTYI
ENPVLMLA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaataaatatgccgcgtctgagcgacacgatggaagaaggaacagtcgct
acctggttaaaaagcgtaggtgacaaggtagaagaaggagacatactagcagagattgag
acagataaagctacaatggagtttgagtcttttaacgagggtgtattattacacattggg
atagaagaggggcaaacagcaaaggtagataccctacttgccatcataggtgaagaagga
gaagacatctcaggactgcttactggtgacgcttccgcgaaagaagaagaaacttcaact
tcagactcaagtgattcagaagataacgcagaggcaacagccgaagatgatacacaagaa
gacacatctagcgatgtgccagaaggagttattgttgtaacaatgcctagactctcagac
acaatggaagaggggacagtagctacctggcttaaaagcgtaggtgatatggtagaagag
ggcgatattcttgcagagatagaaacagataaggctacaatggagtttgagtcttttcaa
tctggaacgctattgcatataggtatcaatgaaggtgaaactgcaaaggtagatgcctta
ctcgctattataggcccagaagggacagatgtttctggagttataaaaagtggtggagcc
cctgcaaaatctgcacctaaaaaagaagaaaagaaagaggagaaaaaagaagcaccaaaa
gcttcaaaagaaaatacaaccagtgcgcctaaggctgctgctccagcaaaagcaactaca
actactagcacaaacggaggacgtatttttgtatcacctctagcaaagaaaatagcagaa
gagaaaggtataaaccttgctcaagtaaaaggaactggagaaaacggtcgtattgtaaag
agtgatgttgagaacttcacaccttcggcaggcggttctgtgcaacagtttgttgcaacc
ggagaagaaagctttgaagagatagaaaactctcaaatgcgtaaagcgattgctcgtggt
cttggtaaatctaagtttacagcacctcattattacctgaacgttgagttcaatatggaa
aatatgatgagtttccgtaaacagtttaacacgcagccagatacaaaggtttcttttaat
gatatgatcattaaagcaacttctattgcgcttaaacaacaccctcaggttaactcacaa
tggtttgatgataagatgcgtcttaaccaccacgtgcacataggtgtagctgtggctgta
ccagatggacttgttgtacctgtagtagagtttgcaaatgagaagtcattacagcaaatt
aatgcagaggtaaagacactagctggtaaagcgcgtgacaagaagcttaccattccagag
atggaaggttctacttttacgatatctaaccttggtatgtttggaataacagactttacg
tctattattaaccagcctaactcggcaatattatctgtaggagcgattgtagagaagcca
gttgtaaagaatggtcaacttgcagtaggtcacacgatgaagcttacacttgcttgtgat
caccgcacagtagatggtgcgacaggagcacagttcttacaaacgcttaaaacatatatt
gagaatcctgtacttatgcttgcatag

DBGET integrated database retrieval system