KEGG   Drosophila erecta: 6546247
Entry
6546247           CDS       T01060                                 

Definition
(RefSeq) cell death protein hid
  KO
K20016  cell death protein hid
Organism
der  Drosophila erecta
Pathway
der04013  MAPK signaling pathway - fly
der04214  Apoptosis - fly
der04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:der00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    6546247
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6546247
   04215 Apoptosis - multiple species
    6546247
SSDB
Motif
Pfam: Herpes_US9
Other DBs
NCBI-GeneID: 6546247
NCBI-ProteinID: XP_001972854
FlyBase: FBgn0107993
UniProt: B3ND87
LinkDB
Position
Unknown
AA seq 419 aa
MAVPFYLPEGGADDVASSSSGASGNSSPHTHPLPSSASSSVSSSGVSSASASSASASSSS
SSSASSSSDGASSAASQSPNTTTSSATQTPMQSPLPTDQVLYALYEWLRMYQSQQSAPQI
FQYPPPQSPSCNFTGGDVFFPHGHPNPNSNPHPRTPRTSVSFSSGEEYNFFRQQQPQPHP
SYPAPSTPQPMPPQSAPPMHCSHSYPQQSAHMMPHHSAPFGMGGTYYAAYTPPPTPNTAS
AGTSSSSAAFGWHGHLHSPLTSTSTPLSAPVAPKMRLQRSQSDAARRKRLTSTGEDEREY
QSDHEATWDEFGDRYDNFTAGRERLQEFNGRIPPRKKKSSNSHSTSSNNPACHTDSRQPD
NASQAESGATNGHISQQRQVERAERQKAKAEKKKPQSFTWPTVVTVFVLAMGCGFFAAR
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggccgtgcccttttatttgcccgagggcggcgccgatgacgtagcgtcgagttcatcg
ggagcctcgggcaactcctccccccacacccacccactcccctcgagcgcatcctcctcc
gtctcctcctcgggcgtgtcctcggcctccgcctcctcggcctcggcctcgtcatcgtct
tcgtcctccgcatcctcgtcctcggacggcgccagcagcgccgcctcgcaatcgccgaac
accaccacctcgtcggccacgcagacgccgatgcagtctccactgcccacagaccaggtg
ctgtacgccctctacgagtggctcaggatgtaccagagccagcagagcgccccgcaaatc
ttccagtatccgccgccgcaaagcccctcttgcaatttcacgggcggcgatgtgttcttt
ccgcacggccacccgaatccgaactcgaatccccacccgcgcaccccccgcaccagtgtg
agcttctcctccggcgaggagtacaacttcttccggcagcagcagccgcagccacatccg
tcgtatccggcgccatcgacaccgcagccaatgccaccgcagtcagcgccgccgatgcac
tgcagccacagctacccgcagcagtcggcgcacatgatgccacaccactccgctcccttc
gggatgggcggcacctactacgccgcgtacacgccgccacccactccgaacacggccagt
gcgggcacctccagctcatcggcggccttcggctggcacggccacctccacagccccctc
acgtcgacctccacgcccttatcggcgccagtggcgcccaagatgcgcctgcagcgcagc
cagtcggatgcggccagacgcaagcgattgacctcgacgggcgaggatgagcgcgagtac
cagagcgatcacgaggccacttgggacgagtttggcgatcgctacgacaactttacggcc
ggccgggagcgtctgcaggagttcaatggacgcatcccgccccggaagaagaagagctcc
aatagccactccaccagcagcaataatccagcctgccacaccgacagccgccagcccgac
aatgcctcccaagcggagagcggtgccaccaatggccacatcagtcagcagcgacaggtg
gagcgcgcagaacggcagaaggcgaaggcagagaagaagaaaccgcagagcttcacttgg
ccaactgttgtgaccgttttcgtcttggccatgggctgtggcttctttgcggcgcgatga

DBGET integrated database retrieval system