KEGG   Desulfurococcus amylolyticus DSM 16532: Desfe_0503Help
Entry
Desfe_0503        CDS       T02136                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
dfd  Desulfurococcus amylolyticus DSM 16532
Pathway
dfd00010  Glycolysis / Gluconeogenesis
dfd00020  Citrate cycle (TCA cycle)
dfd00620  Pyruvate metabolism
dfd00640  Propanoate metabolism
dfd00650  Butanoate metabolism
dfd00680  Methane metabolism
dfd00720  Carbon fixation pathways in prokaryotes
dfd01100  Metabolic pathways
dfd01110  Biosynthesis of secondary metabolites
dfd01120  Microbial metabolism in diverse environments
dfd01130  Biosynthesis of antibiotics
dfd01200  Carbon metabolism
Module
dfd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dfd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desfe_0503
   00020 Citrate cycle (TCA cycle)
    Desfe_0503
   00620 Pyruvate metabolism
    Desfe_0503
   00640 Propanoate metabolism
    Desfe_0503
   00650 Butanoate metabolism
    Desfe_0503
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Desfe_0503
   00680 Methane metabolism
    Desfe_0503
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desfe_0503
Enzymes [BR:dfd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desfe_0503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C MannoseP_isomer SAT
Motif
Other DBs
NCBI-ProteinID: AFL66407
UniProt: I3XR33
LinkDB All DBs
Position
complement(476189..477448)
Genome map
AA seq 419 aa AA seqDB search
MEKTMFKPKIPIEKQVLTTANGDEAVAYAVKQSYVDVVAAYPITPQTIIVEKYSEFVNDG
LVHTEFIPVESEHSAMSACVGAAAAGARAFTATSSQGLALMVEIVYIASALRLPIVMAVV
NRALSAPINIHNDHSDAYLMRDSGWIQLFVENVQETYDTTIQAFKIAEDPRVQLPVAVNL
DGFFLSHTLENFYMLPDDMVYEFLGGPRKLVNVKVDYFSEEVPLVLNPARPLTFGSLDLY
DYYFEHKVQQVEAMRNVPPVVREINEEWYKLTGRRYGDGVVDAYGVEDADIVIVAMGSGA
GTIRSVVKKLREKGEKIGLLKIRMFRPFPYSDVAEILSGAKVVAVMDKAIGPGSFGALYE
DIAASLYDLDERPLLLDYIYGLGGRDLPPSLVYRMIEEVKKDLESKSVERKIRYLGVRE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaccatgttcaagccgaagatccctattgagaaacaggttttaacaaccgct
aatggtgatgaagcagtagcctacgctgtaaagcagagctatgtagatgtggtggcagca
taccctataacacctcagacaattattgttgaaaaatactcggagttcgttaatgatgga
ttagtacacacagagtttataccggttgaatcggagcactcagctatgagtgcttgcgta
ggtgcggcagcggctggtgccagagctttcacggctacatcatcccagggattagcgtta
atggttgaaatagtatatatagcatcggccctaagactaccaatagttatggcagttgtc
aacagggctctctcagcaccgataaacatacataatgatcacagtgatgcatacctgatg
agggactctggatggattcagttattcgtggaaaacgtgcaagagacgtatgacaccact
atacaggcattcaagatagcggaggatccacgtgtgcaactacctgtcgctgtaaacctt
gacgggttcttcctaagccacaccctagagaacttctacatgttaccggatgacatggtc
tatgagttcctagggggtccgaggaaactggtaaacgttaaggtagactatttcagtgag
gaagtaccactagtgttaaacccagccaggcctttaacattcggctcactggatctatac
gattattactttgaacataaagtccagcaggtggaagccatgaggaatgtgcctcctgtt
gtaagggagataaatgaagaatggtataagctaacgggcaggagatatggtgatggagta
gtagatgcatatggcgtggaggacgccgacatagtgattgttgcaatgggtagtggggca
ggcactatcaggagtgttgtgaagaagctaagagaaaagggggagaagataggattgcta
aagataaggatgttcaggcccttcccatacagtgatgtggcagaaattctctcaggcgcc
aaagtagtggctgtaatggataaagctataggacctggctcgtttggcgcgctatacgag
gatatagcggcaagtctatatgatctcgatgagagaccactactactcgactacatctac
ggcctaggagggagagacctgccaccatcactagtctacaggatgattgaagaagtaaag
aaagacctagagtccaagagtgttgaaaggaagataaggtacttaggggtgagggagtag

DBGET integrated database retrieval system