KEGG   Drosophila hydei: 111595475
Entry
111595475         CDS       T05888                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein isoform X1
  KO
K20017  Bcl-2 family protein
Organism
dhe  Drosophila hydei
Pathway
dhe04214  Apoptosis - fly
dhe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111595475
   04215 Apoptosis - multiple species
    111595475
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 111595475
NCBI-ProteinID: XP_023165009
UniProt: A0A6J1LH71
LinkDB
Position
Unknown
AA seq 337 aa
MSSARHIQKHTHHTHTQRVCDTKIINEAQSRHKDLRRAIMPGTSFPTNNDNFSNGFPMVT
TQAERLLQAQNRRKFSFPATLHSAALLEVGQRETTRRRLSNVSDVVTRKLSYTIGWKAAQ
IPAQDIITQGRCLCGHYIKRRLRRSGLFNKKLGLQRIRSILGNSNTTMGIVRDVFPAVQV
LGDELERMHPRIYNGVARQICRNPGGEFHTPDAVSLLLGAVGRELFRVEITWSKVISLFA
IAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINENGGWSGINTHVLPTTNSLNPL
EWTTLVIGVVFGLILLFMFLRFIVNTLIPKIYQRFTS
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgagcagcgctcgccacatacaaaaacacacacaccacacacacacacagcgagtttgc
gacaccaaaataattaatgaagcccaaagtaggcacaaagatctcagacgcgccatcatg
ccaggcacctcattcccaacgaacaatgacaatttcagcaacggctttcccatggtcacg
acccaagccgagcgactgcttcaggcgcagaatcgtcgcaagttcagctttcccgccaca
ctccattcggctgccctgctcgaggtcggacagcgggagacaacccgccggcggctcagc
aacgtcagcgatgtggttacccgcaaactgtcctacactatcggctggaaagctgctcaa
atacctgctcaagacataatcacacagggacgctgtttgtgtggacactacattaagcgg
cggctgcgtcgctcgggactcttcaacaagaaactgggcctgcaacgcattcgcagcata
ttgggcaacagcaacacaactatgggcattgtcagagacgttttcccagcggtgcaagtg
ttgggcgatgagctggaacgcatgcatccgcgcatctataatggtgtcgcccgtcagatt
tgccgcaatcccggcggagagtttcatacaccagatgctgtgagtctgctgctgggcgca
gtgggtcgtgagctgtttcgggttgagatcacgtggagcaaggttatctcattgtttgct
atagccggtggtctgtcggtggattgtgtgcgccagggtcatcccgagtatttgccaaag
cttatggagagcgtttccgaagttattgaagatgagctggtgccttggataaacgaaaac
ggtggctggagtggcatcaatacacacgtattacctactaccaatagcttaaatcccttg
gagtggaccacgctggtaatcggtgtagtatttgggctgattttattatttatgtttttg
cgctttattgttaacacactaattcctaaaatataccaacgatttacgagctga

DBGET integrated database retrieval system