KEGG   Drosophila hydei: 111603800
Entry
111603800         CDS       T05888                                 

Definition
(RefSeq) caspase-1 isoform X1
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dhe  Drosophila hydei
Pathway
dhe04214  Apoptosis - fly
dhe04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dhe00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    111603800
   04215 Apoptosis - multiple species
    111603800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dhe01002]
    111603800
Enzymes [BR:dhe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     111603800
Peptidases and inhibitors [BR:dhe01002]
 Cysteine peptidases
  Family C14: caspase family
   111603800
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 111603800
NCBI-ProteinID: XP_023177317
UniProt: A0A6J1MJU8
LinkDB
Position
Unknown
AA seq 319 aa
MTDECKIRSFGSHNLDNGKINNNTDTIDAKGESSTNSARSGGAASAVAAPINKCVARMPT
DRYAKEYNMNHKHRGQALIFNHETFDIPWLKPRPGTNVDSEELRKALKRLDFDVTVHKDC
TISEILDIVNKAASKDHSDNDCIAIAVLSHGEHGHLYAKDVQYRLDSIWQYLTANNCPTL
AGKPKLFFIQACQGDRLDSGTTLVKNVTETDGDSSTSYKIPIHADFLFSYSTIPGYYSWR
NTENGSWFIQSLIKELNENGKEYNMLTLLTFVSQRVAVDYESNVPTSPMMDRQKQIPCVT
SMLTRILRFTDKPPSSQAG
NT seq 960 nt   +upstreamnt  +downstreamnt
atgacggacgagtgcaaaattcgatccttcggttctcacaaccttgacaacggcaaaata
aacaacaatactgataccatcgacgcaaaaggagaatcgagtacaaattctgctcgaagc
ggtggtgcagccagcgccgtcgcagccccaattaataaatgtgtggctcgcatgcccacc
gaccgatatgcaaaagaatataatatgaatcataaacaccgtggacaggcattgatcttc
aatcacgaaacatttgatataccgtggctaaaaccacgtcccggcacaaatgtggacagc
gaggagctgcgcaaggccctgaaacgtttggatttcgatgtgactgtgcacaaggattgt
acaatcagtgaaattctcgatatagttaacaaggccgcctcgaaggatcacagcgacaat
gattgcatagccattgccgtattatcccatggcgaacatggtcacctctatgccaaagat
gtgcagtacaggctggacagcatctggcaatatttgactgccaacaattgccccacgcta
gcaggtaaaccaaagctattcttcatccaggcctgtcagggcgatcgattggactcgggg
acgacattagtaaagaatgttactgaaacggatggcgattcatcgacaagctacaaaata
cccatacatgccgattttcttttctcatattctacaatacctggatactattcgtggcgc
aacaccgaaaatggctcatggtttatacagtctctcattaaggaactaaatgaaaatggt
aaagagtacaacatgctcacattgttgacttttgtcagtcaacgcgtggcagtggattac
gagtcgaacgtgccaaccagtcctatgatggatcgtcagaagcaaattccatgtgtgacg
tcaatgttaacgcgcattttgcgctttacggacaaaccccctagcagccaggccggctaa

DBGET integrated database retrieval system