KEGG   Desulfovibrio hydrothermalis: DESAM_21144Help
Entry
DESAM_21144       CDS       T02428                                 

Definition
(GenBank) Beta-hydroxyacyl-(Acyl-carrier-protein) dehydratase FabA/FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
dhy00061  Fatty acid biosynthesis
dhy00780  Biotin metabolism
dhy01100  Metabolic pathways
dhy01212  Fatty acid metabolism
Module
dhy_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dhy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DESAM_21144
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DESAM_21144
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dhy01004]
    DESAM_21144
Enzymes [BR:dhy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     DESAM_21144
Lipid biosynthesis proteins [BR:dhy01004]
 Fatty acid synthase
  Component type
   DESAM_21144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT
Motif
Other DBs
NCBI-ProteinID: CCO23425
UniProt: L0RB82
LinkDB All DBs
Position
complement(1483264..1483653)
Genome map
AA seq 129 aa AA seqDB search
MDLRNHIENSATTLESRDGAYTRSFCFKPDFPGFDGHFPDNPILPGVVQVLLGELSSLIG
LSAEYPNKKFTLESVTRCKFLRPVKPDETLCLKFTIKAKELKYITICSLTVNGETAASYQ
LIFSPKADL
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggatcttcgaaatcatattgaaaactccgcgacaacgcttgaaagcagagatggggcg
tacacccgctcattttgtttcaagcccgactttcccggctttgacggacattttcccgat
aaccctatcctgcccggcgttgtacaagttctgcttggcgaactaagcagtctaatcggc
ctgagcgcagaatatccaaataaaaaatttacacttgaaagcgtaacccgctgtaaattt
ctgcgccctgtcaaaccggatgaaaccctgtgcctaaaattcaccattaaagcaaaggaa
ctcaagtatatcaccatttgctccctgacggttaacggcgaaacagcagcatcctaccaa
ttaattttcagccccaaggcggatctatga

DBGET integrated database retrieval system