KEGG   Acidovorax ebreus: Dtpsy_2368Help
Entry
Dtpsy_2368        CDS       T00853                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dtpsy_2368
Enzymes [BR:dia01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Dtpsy_2368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 FAD_oxidored GIDA HI0933_like AlaDh_PNT_C Glutaredoxin Thi4 DAO FAD_binding_3 NAD_binding_8 K_oxygenase DSBA Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: ACM33805
UniProt: B9MCA0
LinkDB All DBs
Position
complement(2519759..2521315)
Genome map
AA seq 518 aa AA seqDB search
MLDANLQAQLKAYLERLQRPVELVATLDDGATSQELRELLQEIRSLSDKITVVEKNDAPV
RKPSFLITNPGVDTGVRFAGVPLGHEFTSLVLALLQVGGHPSKESADLLEQVKGLDGDFH
FETYYSLSCHNCPDVVQALNLMSVLNPRITHTAIDGAVFQDEIKERQIMGVPTVFLNGKN
FGQGRMELAEIVAKIDSGAHARVAAKLNAMEPFDVLVVGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVLDTVDIENYISVSKTEGPKFAIALEQHVNDYDVEVMNLQRAKALKPAATEG
GLVEIELDNGATLKSKTVILSTGARWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKDVAV
IGGGNSGVEAAIDLAGIVKSVTVLEFASELKADGVLQKKLRSLPNVTVILNAQTTEVNGD
GSKVTGLTYKDRTTDEAKTVAVEGIFVQIGLLPNTDWLKGTVDLTRFGEIIIDARGHTNV
PGVFAAGDCTNVPYKQIIIAAGAGATAALSAFDHLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaacctccaagcccaattgaaagcctatctggagcgcctgcagcgcccg
gtggagctggtcgccacgctggacgatggcgccacttcccaagagctgcgggaactgctc
caggagatccgctccctctccgacaagatcactgtggtcgagaagaacgacgcgcccgtg
cgcaagccgtccttcctgatcaccaaccccggggtggacaccggcgtgcgtttcgcgggc
gtccccctgggccatgagttcacctcgctggtgctggcgctgctgcaggtgggcggccat
ccctccaaggaatcggcggacctgctggagcaggtcaagggcctggacggcgacttccat
ttcgagacgtactactcgctgtcctgccacaactgtcccgacgtggtccaggccctgaac
ctgatgagcgtgctcaacccgcgcatcacgcacacggccatcgacggcgccgtgttccag
gacgagatcaaggaacgccaaatcatgggcgtgcccaccgtgttcctgaacggcaagaac
ttcggccagggccgcatggagctggcggagatcgtcgccaagatcgacagcggcgcccat
gcccgcgtggccgccaagctcaacgccatggagccgttcgacgtgctggtggtcggcggt
ggtcccgccggtgccgcggccgctgtgtatgcggcgcgcaagggcatccgcaccggcgtg
gcggccgagcgcttcggcggccaggtgctggataccgtggacatcgagaactacatctcg
gtgagcaagactgaaggccccaagttcgccatcgcgctggagcagcacgtgaacgactat
gacgtcgaggtgatgaacctgcagcgcgccaaggcgctgaagcccgccgcaacggaaggc
ggcctggtggaaatcgaactcgacaacggcgcaacgctcaagagcaagaccgtgatcctg
tcgacaggcgcgcgctggcgcaacatgaacgtgccgggcgaggagcagtaccgcaccaag
ggcgtgacgtactgcccgcactgcgacggcccgctgttcaagggcaaggacgtggcggtc
atcggcggcggcaactcgggcgtagaggccgcgatcgacctggccggcatcgtcaagagc
gtgacggtgctggagttcgccagcgagttgaaggccgatggcgtactgcagaaaaagctg
cgcagcctgcccaacgtgacggtcatcctgaacgcccagaccacggaagtgaatggcgac
ggcagcaaggtcaccggcctgacctacaaggaccgcacgacggacgaggccaagaccgtg
gcggtcgagggcatcttcgtgcagatcggtctgttgcccaacaccgactggctcaagggc
acggtggacctgacgcgctttggcgagatcatcatcgacgcccggggccacaccaacgtg
ccgggcgtgttcgccgcgggagactgcaccaacgtgccgtacaagcagatcatcatcgcc
gcgggggcgggcgcgacggcggccttgtcggccttcgaccacctgattcgccactga

DBGET integrated database retrieval system