Diaphorobacter sp. HDW4A: G7047_01165 Help Entry G7047_01165       CDS       T06499                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dih  Diaphorobacter sp. HDW4A Pathway dih01100   Metabolic pathways dih01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dih00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G7047_01165 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G7047_01165 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QIL78683 UniProt:  A0A6G8CIK5 LinkDB All DBs Position 260103..260342 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKSFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaagaaaatcattgccgaacaactcggtgtggaagag tcccaagtgaccaacgaaaagtccttcgtggccgacctgggcgctgattccctggacacg gtcgaactggtgatggctctggaagatgagttcggcatcgagattcctgacgaagacgca gagaagatcacgacggtgcagaacgccatcgactacgccaacacccatcaaaaggcctga

DBGET integrated database retrieval system