KEGG   Dietzia sp. oral taxon 368: C3V38_09120Help
Entry
C3V38_09120       CDS       T05390                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
dit  Dietzia sp. oral taxon 368
Pathway
dit00250  Alanine, aspartate and glutamate metabolism
dit00410  beta-Alanine metabolism
dit00640  Propanoate metabolism
dit00650  Butanoate metabolism
dit01100  Metabolic pathways
dit01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dit00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    C3V38_09120
   00650 Butanoate metabolism
    C3V38_09120
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C3V38_09120
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C3V38_09120
Enzymes [BR:dit01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C3V38_09120
Amino acid related enzymes [BR:dit01007]
 Aminotransferase (transaminase)
  Class III
   C3V38_09120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AVM64520
LinkDB All DBs
Position
complement(1946879..1948168)
Genome map
AA seq 429 aa AA seqDB search
MTAHLSPLLKQATPVVVDHALGSWIHGTDGRDYLDFTTGIGVTSTGHCHPDVVAAAREQC
GKIIHAQYTTVMHQPLLELTAKLGEHLPAGIDSVFYANSGSEAVEAAVRLARMATGRPNI
VTVQGGFHGRTVAAASLTTAGTRFSAGFSPLMGGVVMTPFPHALRHGWTTDDAVDFALAE
LDYLMATRVDAREIAALLIEPVLGDGGYMATPPRYLQGLRERADRIGALLVLDEVQAGIG
RTGRFWGHQHTEGLVPDVIITAKGIASGFPISAIAASTDLMAKAWPGSQGGTYGGNAVAA
AAGVATLGVVERENLVQCAADRGSQLLAGLRRSLADVSEICDIRGTGLMLGVEFGDPTAP
AGSAGALEAARLATAVQQACVDEDLLTLTCGPTGSVVRLIPALVVTSEEVDAGVERFTRA
VHRVRDGAA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcacctgtcgccccttctcaagcaggccacgcccgtcgtcgtggaccacgcc
ctcggctcgtggatccacggcaccgacggccgcgactacctggacttcaccaccggcatc
ggcgtgaccagcaccggccactgccaccccgacgtcgtggcggccgcgcgcgagcagtgc
gggaagatcatccacgcgcagtacacgaccgtcatgcaccagccgctgctcgagctcacc
gccaagctcggcgagcacctgccggccggcatcgactcggtgttctacgccaactccggc
tccgaggcggtcgaagccgccgtgcggctggcgcgcatggccacgggccgaccgaacatc
gtcaccgtccagggcggcttccacggccgcaccgtcgccgcggccagcctcaccaccgcc
ggcacccgcttctccgccggcttctcccccctcatgggcggcgtggtgatgaccccgttc
ccccacgcgctgcgccacggctggaccaccgacgacgccgtggacttcgcgctggccgag
ctcgactacctcatggccacccgcgtcgacgcccgcgagatcgcggcgttgctcatcgaa
cccgtcctcggcgacggcgggtacatggccactcccccgcgctacctccagggtctgcgc
gagcgcgccgaccggatcggcgcgctgctcgtgctggacgaggtccaggccggcatcggg
cgcaccggccgtttctggggccaccagcacaccgagggcctggtcccggacgtcatcatc
accgccaagggcatcgcgtcgggcttccccatctccgcgatcgcggcgtccaccgacctc
atggccaaggcctggcccggatcccagggcggcacctacggcggcaacgccgtggcggcc
gcggccggggtcgccacgctcggcgtggtcgagcgcgagaacctcgtccagtgcgcggca
gaccgcggatcccagctgctcgcgggtctgcggcgtagcctggcggacgtgagcgagatc
tgcgacatccgcggtaccgggctcatgctgggcgtcgagttcggcgacccgaccgcgccc
gccggcagcgccggcgcgctcgaggccgcgcgcctggcgacggccgtccagcaggcgtgc
gtggacgaggacctgctcaccctgacgtgtgggccgacagggtcggtggtgcgcctcatc
ccggctctggtggtgacctccgaggaggtcgacgccggcgtcgagcgcttcacccgggcc
gtgcaccgggtgcgcgacggggcggcgtga

DBGET integrated database retrieval system