Dyella japonica: HY57_10880 Help Entry HY57_10880        CDS       T03215                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism dja  Dyella japonica Pathway dja01100   Metabolic pathways dja01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:dja00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HY57_10880   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HY57_10880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 Ribosomal_L50 HLH DUF1493 Motif Other DBs NCBI-ProteinID:  AIF47732 UniProt:  A0A075K1Z2 LinkDB All DBs Position 2562814..2563053 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVIEQLGVKEEEVTANASFVDDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQQAVDYIKAHTKE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgtcatcgagcagctgggcgtgaaggaa gaggaagtcacggcgaacgcttcgttcgtggacgatctgggcgctgattcgctggacacc gttgaactggtgatggctctcgaggaagagttcgagaccgagattccggacgaagaagcc gagaagatcaccacggtgcagcaggctgtcgattacatcaaggcccacaccaaggagtga

DBGET integrated database retrieval system