KEGG   Dyella jiangningensis: CH75_14220Help
Entry
CH75_14220        CDS       T03074                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
dji  Dyella jiangningensis
Pathway
dji00061  Fatty acid biosynthesis
dji00780  Biotin metabolism
dji01100  Metabolic pathways
dji01212  Fatty acid metabolism
Module
dji_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:dji00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CH75_14220
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CH75_14220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dji01004]
    CH75_14220
Enzymes [BR:dji01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CH75_14220
Lipid biosynthesis proteins [BR:dji01004]
 Fatty acid synthase
  Component type
   CH75_14220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA PS-DH MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: AHX14222
UniProt: A0A023NSS9
LinkDB All DBs
Position
3066978..3067451
Genome map
AA seq 157 aa AA seqDB search
MSDLTVPFHLPVTVEHIQQLLPHRYPFLLVDRVIELVPDKSVVALKNVTINEPFFQGHFP
GHPVMPGVLIVEAMAQAAGLLTQISSRLKGNTGSPLFYLAKVDNARFNAPVVPGDQLRLE
VTLKRLLRSMGLFEARTMVGDKEVASCELMCAARSDK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacctcaccgtgcctttccaccttccggttaccgtggaacacatccagcagctg
ctgccgcaccgctacccgttcctgctggtcgaccgcgtgatcgagctggtgcccgacaag
agcgtggtcgccctcaagaacgtgaccatcaacgagccgttcttccagggccatttcccg
ggccatccggtgatgccgggcgtgctgatcgtggaagccatggctcaggccgccggcctg
ctcacgcagatctccagccgcctgaagggcaacacgggcagcccgttgttctatctcgcc
aaggtggacaacgcgcgcttcaacgcgccggtggtgccgggcgaccagctacgcctggaa
gtgacgctcaagcgcctgctgcgcagcatgggcctgttcgaggcgcgcaccatggtgggt
gacaaggaagtggccagctgcgagctgatgtgcgccgcgaggtccgacaaatga

DBGET integrated database retrieval system