KEGG   Delphinapterus leucas (beluga whale): 111164795
Entry
111164795         CDS       T05885                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta isoform X1
  KO
K08528  retinoic acid receptor beta
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle05200  Pathways in cancer
dle05222  Small cell lung cancer
dle05223  Non-small cell lung cancer
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111164795 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    111164795 (RARB)
   05222 Small cell lung cancer
    111164795 (RARB)
   05223 Non-small cell lung cancer
    111164795 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111164795 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dle03310]
    111164795 (RARB)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    111164795 (RARB)
Nuclear receptors [BR:dle03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   111164795 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 111164795
NCBI-ProteinID: XP_022410407
UniProt: A0A2Y9LTK2
LinkDB
Position
Unknown
AA seq 448 aa
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFAGQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSTSPSSVENSGVSQSPLLQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtttgactgtatggatgtcctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagcccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcacactgcgcaatcgattgaaacacagagcaccagc
tccgaggaactggtcccgagccctccgtctccacttcctccccctcgggtgtacaagccc
tgcttcgtctgccaggacaagtcatcggggtaccactacggggtcagcgcctgcgagggg
tgtaaggggtttttccgcagaagtattcagaagaacatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccagtactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatcggtcaggaatgacagaaacaagaaaaagaag
gagccttcgaagcaggaatgcacggagagctacgaaatgacggccgagctggacgatctc
acggagaagatccggaaagcccaccaggaaaccttcccctcgctctgccagctgggcaag
tacaccacgaattccagtgccgaccatcgagttcgactggatctgggcctctgggacaaa
ttcagtgaactggctaccaagtgcattattaagatcgtggagtttgctaaacgtctgcca
ggcttcactggcttgaccatcgcagaccaaatcaccctgttgaaggcggcctgtttggac
atcctgattctgagaatctgcaccaggtataccccagagcaagacaccatgacgttttcg
gacggcctgaccctgaatcgaacccagatgcacaacgccgggttcggccccctgaccgac
ctcgtgttcacctttgccggccagcttctgcctctggagatggacgacacggagacaggc
cttctcagcgccatctgcttgatctgtggagaccgtcaggaccttgaggaaccaacaaaa
gtagataagctacaagaaccattgctggaagcactaaaaatttatatcagaaagagacga
cccagcaagcctcacatgtttccaaagatcctcatgaaaatcacagatctccgcagcatc
agtgctaaaggtgcagaacgtgtaattaccttgaaaatggaaattcctggctcgatgccc
cctctcattcaggaaatgctggagaattctgaaggacatgaacccttgaccccaagctcg
agtgggaacacagcagagcacagtcccagcacctcgcccagttccgtggagaacagcggt
gtcagtcagtcaccactgctgcaataa

DBGET integrated database retrieval system