KEGG   Delphinapterus leucas (beluga whale): 111166801
Entry
111166801         CDS       T05885                                 

Gene name
HNRNPK
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein K isoform X1
  KO
K12886  heterogeneous nuclear ribonucleoprotein K
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03040  Spliceosome
dle05203  Viral carcinogenesis
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111166801 (HNRNPK)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111166801 (HNRNPK)
   05203 Viral carcinogenesis
    111166801 (HNRNPK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dle03041]
    111166801 (HNRNPK)
Spliceosome [BR:dle03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    111166801 (HNRNPK)
SSDB
Motif
Pfam: KH_1 ROKNT KH_2 KH_4 KH_5 MOEP19 DJ-1_PfpI
Other DBs
NCBI-GeneID: 111166801
NCBI-ProteinID: XP_022414564
UniProt: A0A2Y9LYR5
LinkDB
Position
Unknown
AA seq 464 aa
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTAT
SQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKL
FQECCPQSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFT
MMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG
GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMA
YEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGAS
IKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYADVEGF
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggaaactgaacagccagaggaaacctttcccaacaccgaaaccaatggcgaatttggt
aaacgccctgctgaagatatggaagaggaacaagcttttaaaagatctagaaacactgat
gagatggttgaattacgcattctgcttcagagcaagaatgctggggcagtgattggaaaa
ggaggcaagaatattaaggctctccgtacagactacaatgccagtgtttcagtcccagac
agcagtggccccgagcgcatattgagtatcagtgctgatattgaaacaattggagaaatt
ctgaagaaaatcatccctaccttggaagagggcctgcagttgccatcacccactgcaacc
agccagctcccgctcgaatctgatgctgtggaatgcttaaattaccaacactataaagga
agcgactttgactgcgagttgagactgttgattcatcagagtctggcaggaggaattatt
ggggtcaaaggtgctaaaatcaaagaacttcgagagaacactcagacaacaatcaagctt
ttccaggaatgttgtcctcaatccactgacagagtcgttcttattggaggaaaacctgat
agggttgtagagtgcataaagatcatccttgatcttatatcagagtctcccattaaagga
cgtgctcagccttacgatcccaatttttatgatgaaacctatgattatggtggttttaca
atgatgtttgatgaccgccgtggacgtcctgtgggatttcccatgcggggaagaggtggt
tttgacagaatgcctcctggtcggggtgggcgtcccatgcctccatccagaagagattat
gatgatatgagccctcgtcgaggacctcctccacctcctcctggacgaggtggccggggt
ggtagcagagctcggaatcttcctcttcctccaccaccaccacctagagggggagatcta
atggcctatgacagaagaggaagacctggagaccgttatgatggcatggttggtttcagt
gctgatgaaacctgggactctgcaatagatacatggagcccatccgagtggcagatggct
tatgaaccacagggtggctctggatatgattattcctatgcagggggtcgtggctcatat
ggtgatcttggtggacctattattactacacaagtaactattcccaaagatctggctgga
tctattattggcaaaggtggtcagcggattaaacaaatccgtcatgagtcaggagcgtcg
atcaaaattgatgagcctttagaagggtccgaagaccggatcattaccattacaggaaca
caggaccagatacaaaatgcacagtacttgctgcagaacagtgtgaagcagtatgcagat
gttgaaggattctaa

DBGET integrated database retrieval system