KEGG   Delphinapterus leucas (beluga whale): 111171379
Entry
111171379         CDS       T05885                                 

Definition
(RefSeq) cytochrome P450 4A4-like isoform X1
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00071  Fatty acid degradation
dle00590  Arachidonic acid metabolism
dle00830  Retinol metabolism
dle01100  Metabolic pathways
dle03320  PPAR signaling pathway
dle04270  Vascular smooth muscle contraction
dle04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111171379
   00590 Arachidonic acid metabolism
    111171379
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    111171379
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    111171379
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111171379
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111171379
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:dle00199]
    111171379
Enzymes [BR:dle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     111171379
Cytochrome P450 [BR:dle00199]
 Cytochrome P450, animal type
  CYP4 family
   111171379
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 111171379
NCBI-ProteinID: XP_022422652
UniProt: A0A2Y9MUI9
LinkDB
Position
Unknown
AA seq 181 aa
MMCLLLTPLVPPKLSLVIPLIQSPRPTHTPICGPGKGLLVLEGQTWFQHRRMLTPAFHYD
ILKPYVGLMADSVRVMLASIRHSLQSDAFRTYSETELTTTGWDRGVPWQQLGSTICSEDK
WEELVSPDSHLEVLGHVSLMTLDTIMKCAFSHQGSIQTDRSVTTLQRQGRALVLTSWGGL
T
NT seq 546 nt   +upstreamnt  +downstreamnt
atgatgtgccttctcctgacacccttggttcctcccaagttgtccctagtcatccctctg
atccagtctccccgacccacacacacacccatctgtggcccagggaaaggtttgctcgtg
ttggaggggcagacgtggttccagcaccggcggatgctgaccccagccttccactatgac
atcctgaagccctacgtgggtctcatggccgactctgtccgagtgatgctggcgtccatc
agacacagcctccagagtgatgcattcaggacgtactctgagacagagctcaccacaact
ggatgggacagaggggtgccctggcagcagcttggatccacaatttgctctgaggacaag
tgggaggagctcgtcagcccggactcgcatctggaggtccttggacacgtctccttgatg
accctggacaccatcatgaagtgcgctttcagccaccagggcagcatccagacagacagg
tcagtgacaacccttcaacggcagggcagggcccttgttctcaccagctggggaggactt
acctga

DBGET integrated database retrieval system