KEGG   Delphinapterus leucas (beluga whale): 111172312
Entry
111172312         CDS       T05885                                 

Gene name
PDCD4
Definition
(RefSeq) programmed cell death protein 4 isoform X1
  KO
K16865  programmed cell death protein 4
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle05205  Proteoglycans in cancer
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111172312 (PDCD4)
   05205 Proteoglycans in cancer
    111172312 (PDCD4)
SSDB
Motif
Pfam: MA3 PCI
Other DBs
NCBI-GeneID: 111172312
NCBI-ProteinID: XP_022424503
UniProt: A0A2Y9N5L0
LinkDB
Position
Unknown
AA seq 469 aa
MDVENEQILNVNPTEPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKVK
RRLRKNSSRDSGRGDSVSDNGSEGLRSGVTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGG
KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDETAFEKTLTPIIQEYFEHGD
TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTNDVEKSF
DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV
LLSMSKGGKRKDSVWGSGGGQQSLNHLVKEIVMLLKEYLLSGDISEAEHCLKELEVPHFH
HELVYEAIVMVLESTGESTFKMILDLLKSLWKSSTITLDQMKRGYERIYSEIPDINLDVP
HSYSVLERFVEECFQAGIISRQLRDLCPSRGRKRFVSEGDGGRLKPESY
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggatgtagaaaacgagcagatactgaatgtaaaccctacagagcctgataatttaagt
gactctctcttttctggtgatgaagaaaatgctgggactgaggaaataaagaatgagata
aatggaaattggatttcggcatcctccattaatgaagctagaattaatgccaaggtgaaa
aggcggctacggaaaaactcgtcccgggactccggcagaggcgattccgtcagtgataac
ggaagtgaaggccttagaagtggagtaactgtaccaaccagtccaaagggaaggttgcta
gataggcgatccagatctgggaaaggaaggggactaccaaagaaaggtggtgctggaggc
aaaggtgtctggggtacacctggacaggtatatgatgtggaggaggtagatgtgaaagat
cctaactatgatgatgaccaggaaaactgtgtttatgaaactgtagttttgcctttggat
gaaacggcatttgagaagactttaacaccaatcatacaggaatattttgagcacggagat
actaatgaagttgcggaaatgctaagagatttaaatcttggtgaaatgaaaagtggagta
ccagtgttggcagtgtcattggcattggagggaaaagctagtcatagagaaatgacatct
aagcttctttctgacctttgtgggacagtaatgagcacaaatgatgtagaaaaatcattt
gataaattgttgaaagatctacctgaattagcattggatactcctagagcaccacagttg
gtgggccagtttattgctagagctgttggagatggaattttatgtaatacctatattgat
agttacaaaggaactgtagattgtgtacaggctagagctgctctggacaaggctaccgtg
cttctgagtatgtctaaaggtggaaagcgcaaggacagtgtttggggctctggaggtggg
cagcagtctcttaaccaccttgttaaagagattgttatgctgctgaaagagtatttactc
tctggagacatatctgaagctgaacattgccttaaggaactggaagtacctcattttcac
catgagcttgtatatgaagccattgtaatggttttagagtcaactggagaaagtacattt
aaaatgattttggacttattaaaatctctttggaaatcttctaccattactctagatcaa
atgaaaagaggttatgagagaatttacagtgaaattccagacattaatctggatgtccca
cattcatactctgtgcttgagcgatttgtagaagaatgttttcaggctggaataatttcc
agacaactcagagatctttgtccctcaaggggcagaaaacgttttgtaagtgaaggagat
ggaggtcgtcttaaaccagagagctactga

DBGET integrated database retrieval system