KEGG   Delphinapterus leucas (beluga whale): 111172789
Entry
111172789         CDS       T05885                                 

Gene name
BCL6
Definition
(RefSeq) B-cell lymphoma 6 protein
  KO
K15618  B-cell lymphoma 6 protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04068  FoxO signaling pathway
dle05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111172789 (BCL6)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111172789 (BCL6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111172789 (BCL6)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    111172789 (BCL6)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-C2H2_jaz DZR zf-C2HE zf-C2H2_6 DUF3342 Zn-ribbon_8
Other DBs
NCBI-GeneID: 111172789
NCBI-ProteinID: XP_022425559
UniProt: A0A2Y9MT32
LinkDB
Position
Unknown
AA seq 706 aa
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
CRKFIKASEAEMVPAIKPPREDFLNSRMLMPQDIMAYRGREVVENSLPLRNAPGCESRAF
APSLYNGLSTPPASYPMYGHLPVSSFLFSDEELRDARMPVANPFPKERTLPCDSARPVPS
EYSRPAMELSPTVGHNNVYSPKEAALEEARSDMHYSVAEGPKPAAPSARSAPYFACDKAG
KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQTSG
SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPAACQPPMEP
ETLDLQSPTKLSTSGEDSTIPQASRLNNIVNRSLTGSPRSSSESHSPLYLHAPKCTSCGS
QSPQHAEMCLHATGPTFPEELGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggcctcaccggctgacagctgtatccagttcacccgccacgccagtgacgttcttctc
aaccttaatcgcctccggagccgcgacatcttgacggatgttgtcatagtggtgagccgg
gagcagttccgagcccataagacggtcctcatggcctgcagtggcctgttctacagcatc
ttcacagaccagctgaaatgcaacctcagtgtgatcaacctggatcctgagatcaacccg
gaggggttctgcatcctcctggacttcatgtacacgtctcggctcaatctgcgggagggc
aacatcatggccgtgatggccacagctatgtacctgcagatggagcatgtcgtggacact
tgccggaagttcatcaaggccagtgaagcagagatggtccctgccattaagcctccccgt
gaagacttcctgaacagccggatgctgatgccccaagacatcatggcctatcggggccgg
gaggtggtggagaacagcctgcccctgaggaacgcccctgggtgtgagagcagagccttc
gcccccagcctgtacaatggcctgtccacgccgccagcctcgtaccctatgtatggccac
cttccggtcagcagcttcctcttctccgacgaggagctgcgggatgcccggatgcctgtg
gccaaccccttccccaaggagcggaccctcccctgcgacagtgccaggccagtccccagt
gagtacagtcggccggccatggagctgtcccccactgtgggccacaacaacgtgtactca
cccaaggaggcagccctggaggaggcacggagtgatatgcactacagtgtggccgagggc
cccaagcctgctgccccctcggcccggagcgccccatacttcgcctgtgacaaggccggc
aaagaagaagagaggccctcgtcggaggatgagattgccctgcatttcgagccgcccaat
gcacccctgaaccggaagggtctggttagcccgcagagcccccagaagtccgactgccaa
cccaactcacccacggagtcctgcagcagcaagaacgcctgcatcctccagacctccggg
tcccctccggccaaaagccccactgaccccaaagcctgcaactggaagaagtacaagttc
atcgtgctcaacagcctcaaccagaatgccaaaccagaggggcccgagcaggccgagctg
ggccgcctttcccctcgagcctacactgccccagcggcctgccagccgcccatggagccc
gagacccttgacctccagtccccaaccaagctcagcaccagtggggaggactccaccatc
ccacaggccagcaggctcaataacatcgtcaacaggtcactgaccggctccccacgcagc
agcagtgagagccactctccgctctacctgcacgcccccaagtgcacgtcctgtggctct
cagtccccgcagcacgcagagatgtgcctccacgccactggtcccacgttccccgaggag
ctgggagagacccagtctgagtactcagattccagctgtgagaacggggccttcttctgc
aatgagtgtgactgccgcttttctgaggaggcctccctcaagaggcatacgctgcagacc
cacagtgacaaaccctacaagtgtgaccgctgccaggcctcctttcgctacaagggcaac
ctcgccagccacaagaccgtccacacgggtgagaagccctatcgctgtaacatctgcggg
gcccagttcaaccggccagccaacctgaaaacccacacccgaattcactccggagagaag
ccctacaagtgcgaaacgtgcggagccagatttgtccaggtggcccacctccgtgcccac
gtgctcatccacactggcgagaagccctatccctgtgaaatctgtggcacccgtttccgg
caccttcagactctgaagagccacctgcgaatccacacgggagagaaaccttaccattgt
gagaaatgtaacctgcatttccgtcacaaaagccagctgcgtcttcacttgcgccagaag
cacggtgccattaccaacaccaaggtgcaataccgtgtgtccgccactgacctgcccccg
gagctccccaaagcctgctga

DBGET integrated database retrieval system