KEGG   Delphinapterus leucas (beluga whale): 111173962
Entry
111173962         CDS       T05885                                 

Gene name
EIF4B
Definition
(RefSeq) eukaryotic translation initiation factor 4B isoform X1
  KO
K03258  translation initiation factor 4B
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03013  RNA transport
dle04150  mTOR signaling pathway
dle04151  PI3K-Akt signaling pathway
dle05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    111173962 (EIF4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    111173962 (EIF4B)
   04150 mTOR signaling pathway
    111173962 (EIF4B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    111173962 (EIF4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dle03019]
    111173962 (EIF4B)
   03012 Translation factors [BR:dle03012]
    111173962 (EIF4B)
Messenger RNA biogenesis [BR:dle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     111173962 (EIF4B)
   mRNA cycle factors
    Stress granule specific factors
     111173962 (EIF4B)
Translation factors [BR:dle03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    111173962 (EIF4B)
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 111173962
NCBI-ProteinID: XP_022427795
UniProt: A0A2Y9N0T1
LinkDB
Position
Unknown
AA seq 609 aa
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVPKPVSWADETDDLEGDVSTTWHSNDD
DVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEDSIKEFFRGLN
ISAVRLPREPSNPERLKGFGYAEFEDLDSLFTALSLNEESLGNRRIRVDVADQAQDKDRD
DRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDS
YRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED
RYERRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSASTSQSSRAASI
FGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERSRTGS
ESSQTGTSSTSGRNARRRESEKSLENETPNKEEDCQSPTSKPPKPEQPLKVMPAPPPKEN
AWVKRSSNPPARSQSSDTEQQSPTSGGGKVVPAQPSEEGPVRKADENKVDGVSAPKGQSG
NCSRGPGDGGNKDLWKESDRKDGKKDQDSRSAPEPKKAEDPASKFSSASKYAALAVDGED
ENEGDDYTE
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggcggcctcagcaaaaaagaagaataagaaggggaagactatctccctaacagacttc
ctggctgaggatggagggactggtggaggaagcacctatgtccccaaaccagtcagctgg
gctgatgaaacagatgacctagaaggagatgtttcaaccacttggcatagtaatgatgat
gacgtgtatagggcacctccaattgaccgttccatcctgcccactgctccacgggctgct
cgggaacccaatatcgaccggagccgtcttcccaaatcaccaccctacactgcttttcta
gggaacctgccctatgatgtgaccgaagactccattaaggaattctttagaggattaaat
atcagtgcagtgcgtttaccacgtgaacccagcaatcctgagaggttgaaaggttttggt
tacgctgagtttgaggacctggattccttgttcactgccctgagcctcaatgaagagtct
ctaggtaacaggagaattcgagtggacgttgctgatcaagcccaggataaagacagggat
gatcgttcttttggccgcgatagaaatcgggattctgacaaaacagatacagactggagg
gcccgtcctgctacagacagctttgatgactacccacctagaagaggtgatgatagcttt
ggagacaagtatcgagatcgttacgattcagaccgatatcgtgatgggtatcgggacagt
taccgtgatggcccacgccgggacatggatcgatacgggggccgagatcgctatgatgac
cgaggcagcagagactatgatagaggctacgattccaggataggcagtggcagaagagca
tttggtagtgggtaccgtagggatgacgactacagaggaggcggggaccgctatgaagac
agatatgaacgacgagatgaccggtcatggagctccagagacgattactctcgggatgat
tataggcgagatgatagaggtcccccccaaagacccaaactgaacctaaagcctcggagt
actcctaaggaagatgattcctctgctagcacatcccagtccagtcgagcagcctctatc
tttggaggggcaaagcctgttgacacagctgctagagaacgagaagtagaagagcggcta
cagaaggaacaggagaaactgcagcgtcagctggatgagccaaaactagaacgacggcct
cgggagagacacccaagctggcgaagtgaagaaactcaggaacgatcgaggacaggaagt
gagtcatcacaaacggggacctcatccacatctggcagaaatgcacgaaggagagagagt
gagaagtctctagaaaatgaaacacccaataaagaggaagactgtcagtctccaacttct
aagcctcccaaacctgaacagcctctaaaggtaatgccagcccctccaccaaaggagaat
gcttgggtgaagcgaagttctaaccctcctgctcgatctcagagctcagacacagagcag
cagtcccctacaagtggtggagggaaagtagttccagctcaaccatctgaggaaggacca
gtaaggaaagcagatgaaaataaagtagatggggtgagtgccccaaaaggccaaagtgga
aattgcagccgtggtccaggagatggagggaacaaagacctctggaaggagtcagatagg
aaagatggcaaaaaggatcaagactccagatctgcacctgagccaaagaaagctgaagat
ccagcctctaagttcagttctgcaagcaagtatgctgctcttgccgttgatggtgaagat
gaaaatgagggagacgattacaccgaatag

DBGET integrated database retrieval system