KEGG   Delphinapterus leucas (beluga whale): 111175212
Entry
111175212         CDS       T05885                                 

Gene name
BRCA2
Definition
(RefSeq) breast cancer type 2 susceptibility protein
  KO
K08775  breast cancer 2 susceptibility protein
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle03440  Homologous recombination
dle03460  Fanconi anemia pathway
dle05200  Pathways in cancer
dle05212  Pancreatic cancer
dle05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    111175212 (BRCA2)
   03460 Fanconi anemia pathway
    111175212 (BRCA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111175212 (BRCA2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    111175212 (BRCA2)
   05224 Breast cancer
    111175212 (BRCA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dle04121]
    111175212 (BRCA2)
   03036 Chromosome and associated proteins [BR:dle03036]
    111175212 (BRCA2)
   03400 DNA repair and recombination proteins [BR:dle03400]
    111175212 (BRCA2)
Ubiquitin system [BR:dle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    111175212 (BRCA2)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     111175212 (BRCA2)
DNA repair and recombination proteins [BR:dle03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     111175212 (BRCA2)
   FA (Fanconi anemia) pathway
    Downstream FA components
     111175212 (BRCA2)
SSDB
Motif
Pfam: BRCA-2_helical BRCA2 BRCA-2_OB3 BRCA-2_OB1 Tower
Other DBs
NCBI-GeneID: 111175212
NCBI-ProteinID: XP_022430323
UniProt: A0A2Y9NLY0
LinkDB
Position
Unknown
AA seq 3435 aa
MPIGCKERPTFFEIFKTRCNKADLGPISLNWFEELSSEAPPYNSEPLEESEYKISSYETN
PFKTPQRKPYHQLASTPIIFKERGLTLSLYQSPLNELDKFRLDSGKDIASGKHKSCCMTK
VKMNQVNDVTSPPPNSSLSESPVILRCTHVTPQREKSVICGSLFHTPKLMKGQTPKRISE
SLGAEVDPDMSWSSSLATPPTLSSTVLIVRDEEASATVFPNDSTAISKSYSSNHDESLKK
NITFIPSGPDSENKNQTEAKTHGLEKMLEDSFGKVNSCKDHFEKSMPHVLEDEVCETVAD
ISEEDSFPVCVSKYKTRNLQKIKTGKTRKNIFNETKTDEYEEAKMQMTENKHSFVPEMEP
NDSDPLDSNVINQKPPGNGTDKISREIVPSSASEWSHLTLSGLNGTQMEKTSLLHISSSD
QNNSEDVIGTEKEGTNFITLENSLLHISSISKTVKILNEETVVKKRDEGQCLESREDSTV
VGKQALSDSSLIASPLQGIKKSVFRIRESPEKTFRADFSSNMTDANFKKEPEASKSGSEV
QTVCSQKEDFLHTSSVDNGSWPATTKHTSVALKNAGLISSLKKKTKKFIYAICDETSYQG
LKMQKDQESELTNSSVQFEAKPLEAPHTFTNVDSGLLHSSVKKNCLQNDSEEPALSVISS
FGTIMRKCSNNESSSNNNKTVSQDLDYKEAKINKEKLQSFITTETGYVSCLQEKHCEDDP
KSQRVSDIKEKVLPAVFHPALPHSEECNDILFQSQESFLHGHDNTTILTPSSKDLLSNPV
VISRGKESYKMSEKIKSENCEAGFELTKSISMEKNQETCVVNENSKKAELLSPEKYITEA
SPSMKVQFNQNTNLAVIQKDQEETTLISKITVPPNSEELFPDKEDNFVFQTTTERNIPVL
GNIKEVHEADLSCLREPVPKNSAIVACTDIDDGQAAKVSITKDFGSSDVVCDLAEKNRNN
VKQPPKMTLGQDSKSDVSLDIDMKSNRNNDCMDKWAGLSDWISSHNFGSGFRTASNKEIK
LSEHNTKKSKMLFKDIEEHYPASLACVEIVNTVSLENQKKESRPHELDSQSVNTVSGYVQ
SSAVVSDSGNSHTIPLVLSLKRDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKP
SHMLQSNPFEMPENQITVLDTTSEEWKDVDLHLTINAPSLSQVGSSKKCKGIVGGKQKLA
CFSTTNCNKSASGYLTDKNEVEFRGFYSARGAKLNVSSESLQKAMKLFGDIENVSEETPA
EVDPGSFSSSQCNDSDVSMFKVENYSNDKNLSEKNNECQLTLQNNIEMTSGIFVKEYTED
CRRNTENEDNKCTGFVCNLESDGNASSKNDTVYVHKDENGLPCIDQQNIHLKLSSQFMKE
GNIQIKGLSDLTCLEVVKAEETFNVNMSNKKESTANKMRQNIKDFDVFDLSFQTASGKNI
RVSKESLNKVVNFFDEKSAEELNNFSDSSNSELLSGININKIDISSHEETDMVKNKILKG
GDPVGIKNQVLTLQQRPECEIKKIIEPTMLGFHTASGKKVKIAKESLDKVKNLFDEKKQN
NSEITNFSHQGAKTLKDRELCKEGLELACETVEVTAPKHEEMQYSLEEKKLVSKETGMPP
RLLSDHLYRQSENLKISNSISPKVKVHENIEEETKSPITCYTDQSTCSAIENSALAFYTG
RGRKISVSQASLFEAKKWIREGELNNQLEKINSAKVICLKEYPGDCVGNPSCGNSSNSII
TENDKNLSEKQDSTSLSNSMSNSYSYHSDFSHSNELFNKSEYLSKNKSHNSDIESVVRNV
KDRKNTSLSEVISTVREANINPQAVDKDSCVQKLVTDSSPCKNTNTAVEVAISDSNNFET
EQPALSIASDKIAFVSHETKVRERFTDNCRKVTKQNTEGESGTGRTKIVTHSHKALGDSE
DIIFPNSPDSEEHSMHSHEVFPDIQSEHLLQHDQSISGLEKVSKTPLCHINLKTSDKCKF
NTGKCPKSVSSLNVCGIFSTASGKSVQVSDAALQKARQVFSKTEDSAKQLFPKVSFKSNE
EHSDKFARGGNTVIHTPQNLLSSAFSGFSTASGKQVPVSESAFCKVTGMFEEFDLIGTAC
SLQHSPPSRQDVSRMLTLSCIDKRTSEHSVSSKMGKAYNKEFKLSNNYNIESGSSENNHA
IKASPYLSQFKQDKQQLMSGTNVSHIDNIRLLGKEQALPKNIKMEIGKTETFPDFPMKTN
TEVCSPNSKDPEKYFETEAVEIAKAFMEDDELTDSELLSHAKHSHFTCQKNKETVLINSG
IGKRRGDALVTVGEPPIKRNLLNEFDRIIENQGKYLKASKSTPDGTMKDRRLFMHHISLE
PVTCGPSCTSTERREMQNPNFTASGQEFLSKSHFSEHPTLEKSSSSLSVSGQPLCKVPAP
RNEKRRHSITTGKPMKVFVPPFKTKSHVHRDEQCVNRNTNFEENKQKQKNIDEHGSGDHE
NNVNDSEIHQTTTMLFTKGEEEPLDLITNLQTARDIQDMRIKKKQRQRIFPQPGSLYLAK
TSTMPRISLKVAVEGRVPTACSHKQLYRYGVSKHCVKINSRNAESFQFHTQDYFGKESLW
AGKGIQLADGGWLIPSNDGMAGKEEFYRALCDTPGVDPKLISRVWVYNHYRWIIWKLAAM
EFAFPKEFANRCLSPERVLLQLKYRYDMEIDRSRRSAIKKIMERDDTAAKTLVLCVSEII
SLSTNISETSSSKTNSMDTTKVAVVELTDGWYAIKAQVDPPLLALLKNSRLTVGQKIIIH
GAELVGSPDACTPLEAPESLMLKISANSTRPACWYAKLGFFSNPRPFPLPLSSLFSDGGN
VGCVDIIIQRAYPIQWMEKTSSGLYIFRNEREEEKEATKYAEAQQKKLEALFTKIQAEFE
EHEENITERCIPSRALTRQQVHALQDGAELYEAVKDSPDPSYLEGYFSEEQLRALNNHRQ
TLNDKKQAQIHVELRKAMESAEQGEQILPRDVTPVWKLRITSCKRKEKDSVVLSIWRPSS
DLYSLLTEGKRYRIYHLAASKSKSKSKRANIQLTATKKTQYQQLPASDEILLQVYQPREL
LHFNKLLDPDFQPPCSEVDLIGFVVSVVKKIGLAPLVYLSDECHNLLAIKFWIDLNEDII
KPHMLIAASNLQWLPESRSGIPTLFAGDFSMFSASPKEGHFRETFHKMKNTIENIDIFCN
DAENKLIRILNTNNPKWSTPTKDYTSAPHTAQTVLGTGNKFLMSSPSSEMDYESPLSLCK
LKGKSVSTPAAAQMTSKSCCKGEKETDDPKTCKKRRALDFLSRLPVPPPVSPICTFVSPA
AQKAFQPPRSCGTKYETPMKKKELNSPQMTPLKKFNDISLLEGDSIADEELALINTQALL
SGSAGENQLKSISESTRTTPTGPKDYLRLKRPYTASVIKEQGNSPAGTEEQKANMQDTST
MKTTSKRLQRRQKPK
NT seq 10308 nt   +upstreamnt  +downstreamnt
atgccgattggatgcaaagagaggccaacgttttttgaaatttttaagacgcgatgcaac
aaagcagatttaggaccaataagccttaattggtttgaagaactttcttcagaagctcca
ccctataattctgaacctttggaagaatcagaatataaaatcagcagttatgaaacaaac
ccatttaaaacaccacagaggaaaccttatcatcagttggcttcaactccaataatattc
aaagagcgaggtctaactctgtcactgtaccagtctcctttaaatgaattagataaattc
agattagattcaggaaaggacattgctagtggtaaacataaaagttgttgcatgacgaag
gtgaaaatgaatcaagtaaatgatgttaccagcccacctccaaattcttctcttagtgaa
agtcctgtgattctacgatgtacacatgtaacaccacaaagagaaaagtcagtgatatgt
ggaagtttatttcatacaccaaagctcatgaagggtcagacaccaaaacgtatttccgaa
agtttaggagccgaggtggatcctgatatgtcttggtcaagttctttggccacaccacca
acactaagttctactgtgctcatagtcagagatgaagaagcatctgcaactgtatttcct
aatgatagtactgctatttcaaaaagctattcttctaaccatgatgaaagtctgaagaaa
aatattacgtttatcccttctgggccagacagtgaaaacaaaaatcaaacagaagctaaa
actcatggattggagaaaatgttagaggattcatttggtaaagtaaatagctgcaaagac
cattttgaaaagtcaatgccacatgtcctagaagatgaagtatgtgaaacagttgcagat
atctctgaagaagatagttttccagtatgtgtttctaaatataaaacaagaaatctccaa
aaaataaaaactggcaagactaggaaaaatattttcaatgaaacaaaaactgatgaatat
gaagaagctaaaatgcaaatgacagaaaataaacattcgtttgtacctgaaatggagcca
aatgacagtgatccattagattcaaatgtaataaatcagaagccccctgggaatggaact
gacaaaatctccagggaaattgtaccatcttcagcctctgaatggtctcacctaaccctc
tcgggtctaaatggaacccagatggagaaaacatccctactgcatatttcttcttctgac
caaaataattcagaagacgtcataggtacagagaaagaaggtaccaacttcattacttta
gaaaattctttgctgcatatttcaagcatatcaaaaacagtgaagatattaaatgaggaa
acagtggtaaaaaagagagatgaagggcagtgtcttgagtctcgtgaagattccactgtt
gtgggaaagcaagcactatctgattcttctctaatagcttctccacttcagggtatcaag
aagtctgtattcaggataagagaatcacctgaaaagactttcagagcagatttctcaagc
aatatgactgatgcaaactttaaaaaagaaccagaagcctctaaaagtggatcggaagta
caaactgtttgttcacagaaagaggattttttacatacaagttcagttgataatggcagc
tggccagccactaccaaacatacttctgtagctttgaagaacgcaggtttgatatccagt
ttgaaaaagaaaacaaaaaagttcatttatgctatatgtgatgaaacatcttatcaagga
ctgaaaatgcagaaagaccaagaatcagaactaactaactcttcagtccaatttgaagca
aagcctttggaagcaccacatacatttacaaatgttgattcaggtttattgcattcttct
gttaaaaaaaactgtttacagaatgattctgaagaaccggctttgtctgtaatcagctct
tttgggacaattatgagaaaatgttctaataatgaaagcagttctaataataataaaaca
gtatctcaggatcttgattataaagaagcaaaaattaataaggaaaaactgcagtcattt
ataaccacagaaactggttatgtgtcatgcttgcaggaaaagcactgtgaagatgatcca
aaaagccagagagtttcagatataaaggaaaaagtattgcctgcagtatttcaccctgca
ttgccacattcagaggaatgtaatgatattctcttccaatcccaggaaagctttttacat
ggccatgataataccaccattttaactcctagctccaaggatcttctgtcaaatccagtt
gtgatttctagaggaaaagaatcatataaaatgtcagagaaaataaaatctgagaattgt
gaagctggttttgaattaaccaaaagtatttccatggaaaagaatcaagaaacatgtgtt
gtaaatgaaaattctaaaaaagctgagctgttgtcacctgagaaatacataacagaagca
tcaccttctatgaaggtacaattcaaccaaaatacaaatctcgcagtaatccaaaaagac
caagaagaaactactttaatttcaaaaataactgtccctccaaactctgaagaacttttc
ccagacaaagaggataattttgtctttcaaacaactactgaaaggaatattcctgtttta
ggaaacattaaggaagttcatgaggcagacctcagttgtttaagagaacctgttcccaag
aactctgccatagtagcatgtacagacatagatgacggacaagcagccaaagtgtcgatt
acaaaagattttggttcatcagatgtagtctgtgatcttgcagagaagaatagaaataat
gtaaagcaaccaccaaaaatgactctaggtcaagattcaaagtcagatgtctcgttggat
atagatatgaaatcaaacagaaataatgattgcatggacaaatgggcaggactctcagat
tggatttcaagtcacaattttggaagtggcttcagaacagcttctaataaagaaataaag
ctctctgaacacaacactaagaaaagtaaaatgctcttcaaagatattgaagaacattat
cctgctagcttagcctgtgttgaaattgtaaataccgtatcattagaaaatcagaagaaa
gaaagcagacctcatgaacttgattcacagtcagttaatactgtatctgggtatgtgcag
agtagtgcagttgtttctgatagtggaaatagtcacacaattcctctagttttatcttta
aagcgagactttaactcaaaccataatttaacacctagccaaaaggcagaaattacagaa
ctttctactatattggaagaatcaggaagtcagtttgaatttacacagtttagaaaacca
agccacatgttacaaagtaatccatttgaaatgcctgaaaaccagataactgtcttggat
accacttctgaggaatggaaagatgttgatcttcatctcacaattaatgccccatctctc
agtcaggtgggtagcagcaagaaatgtaaaggtatagttggaggtaagcaaaagttggct
tgcttctcaacaacaaactgtaacaaaagtgcttctggttatttaacagataaaaatgaa
gtggagtttaggggcttttattctgctcgtggcgcaaaactgaatgtttctagtgaatca
ttgcagaaagccatgaaactgttcggtgacattgagaatgttagtgaggaaactcctgca
gaagtagatccgggaagtttctcttcaagtcagtgtaatgattctgatgtttcgatgttt
aaggtagaaaattacagcaatgataaaaatttaagtgagaaaaataatgaatgccaacta
acgctacaaaataacattgaaatgactagtggcatttttgtcaaagaatatactgaagac
tgcaggagaaatactgaaaatgaagataacaaatgtactggttttgtttgtaacttagaa
tctgatggcaatgcttcaagtaaaaatgatacagtttatgttcataaagatgaaaatggc
ttgccatgtattgatcaacaaaacatacatctaaaattatctagccagtttatgaaggag
ggaaacattcaaattaaaggtttgtcagatttaacttgtttggaagttgtgaaagctgaa
gaaacatttaatgttaatatgtcaaataaaaaagagtcaaccgctaacaagatgaggcaa
aatataaaagattttgatgtttttgatttgtcctttcagactgcaagtgggaaaaacatc
agagtctctaaagagtctttaaataaagttgtaaatttctttgatgaaaaatctgcagaa
gaactgaataacttttcagattcctcaaattctgaattactttctggcataaatatcaat
aaaatagacatttcaagtcatgaggaaacagatatggtcaaaaacaaaatattgaaagga
ggcgacccagttggtattaaaaatcaagtactgactctccagcagagacctgaatgtgaa
atcaaaaagatcatagaaccaaccatgttgggttttcatacagctagtgggaaaaaagta
aaaattgcgaaggaatctttggacaaagtgaaaaatctttttgatgaaaaaaagcaaaat
aatagtgaaatcactaatttcagccatcaaggggcaaagactctaaaggacagagagcta
tgtaaagaagggcttgaattagcatgtgagacagttgaagtaactgccccaaagcatgaa
gaaatgcagtattctctagaggagaaaaagcttgtttctaaggagacaggcatgccaccc
aggctcttaagtgatcatttatacagacaaagtgaaaatctcaagatatcaaatagtatc
tctccgaaagttaaagtacatgaaaatatagaagaagaaacaaaaagtcctataacttgt
tatacagatcagtccacttgttcagccattgaaaattcagctttagccttttacacagga
cgtggtagaaaaatttctgtgagtcaggcttcactatttgaagccaaaaaatggattaga
gaaggagaattgaataatcaactagaaaaaataaattctgccaaggttatatgtttaaag
gaatatcctggagattgtgtaggaaatccttcatgtggaaatagttcaaacagtatcata
actgaaaatgacaaaaatctctctgaaaaacaagattcaacttccttaagtaacagcatg
tctaacagctattcatatcattctgatttttctcattccaatgagttatttaataagtca
gagtatctctcaaaaaataaaagtcataattctgatattgagtcagtagtgaggaatgtc
aaagatagaaaaaacactagtttatctgaagtaatatccactgtaagagaagcaaacata
aacccacaagctgtagacaaagatagttgtgttcagaaacttgtcactgactcttcacca
tgcaaaaatacaaacacagctgttgaagtggccatatctgattcaaataattttgagaca
gagcaacctgcactcagtatagcaagtgataaaatagcctttgtttctcatgaaacaaaa
gtgagagagaggtttacagacaactgcaggaaggtaactaagcaaaacactgagggtgaa
tcaggcactggccgaacaaaaattgtgacacattctcataaggcattgggtgattcagag
gatattatttttcctaactctccagatagtgaagaacatagtatgcattcacacgaggtt
tttcctgacattcaaagtgaacaccttttacaacatgaccaaagtatatctggattggag
aaagtttctaaaacaccactttgtcatattaatttgaaaacttctgataagtgtaaattt
aacacgggaaaatgtcccaagtccgtctcttctctaaacgtttgtgggatttttagcaca
gcaagtggaaaatctgtacaagtatcagatgctgccttacaaaaggcaagacaggtattt
tctaagacagaagatagtgctaagcaactctttcccaaagtatcatttaaaagtaatgaa
gaacattcagacaagtttgcaagaggaggaaatactgtgatacataccccccaaaattta
ctgtcatctgctttctctggatttagtacagcaagtggaaaacaggttccagtttctgag
agtgccttttgcaaagttacgggaatgttcgaggaatttgatttaattggaactgcatgt
agtcttcagcattcacctccatctagacaagatgtatcaaggatgcttactctttcttgt
attgataagagaacctcagaacactctgtaagctccaaaatgggaaaagcctataataaa
gagtttaaattatcaaacaactataacattgaaagtggttcttcagaaaataatcatgct
attaaagcttctccatatctctctcagtttaagcaagacaaacaacagttgatgtcagga
accaatgtatcacacattgataacattcgtcttttgggtaaagaacaagctttacctaaa
aatataaaaatggaaattgggaaaactgaaacttttcctgattttcctatgaaaacaaat
acagaagtttgttctcctaactccaaagatccagaaaagtattttgaaacagaagcagta
gagattgccaaagcctttatggaagatgatgagctgacagattctgagcttctaagccac
gccaaacactctcattttacatgccaaaaaaacaaggaaacggttttgataaattcagga
attggaaaaagaagaggagatgcacttgtcacagttggagaacccccaatcaaaagaaac
ttgttgaatgaatttgacaggataatagaaaatcaaggaaaatacttaaaggcttcaaaa
agcactccagatggcacaatgaaagatagaagattgtttatgcatcacatttctttagag
ccagttacctgtggaccctcttgcacaagtacggaaaggcgagaaatgcagaatccaaat
ttcactgcatctggtcaagaatttctatctaaatctcatttttctgaacacccgaccttg
gaaaagtcttcaagcagtttatcagtttcagggcagccactttgtaaggttcctgcccca
agaaatgaaaaaaggagacactcgataactacaggcaaaccaatgaaagtctttgtccca
ccttttaaaactaaatcacatgttcacagagatgaacagtgtgttaacaggaatactaat
ttcgaggaaaacaaacaaaaacaaaaaaacatagatgaacatggctctggtgatcatgaa
aataatgttaatgacagtgaaattcatcaaacaacaactatgcttttcacaaagggtgaa
gaagaacctttagatttaattacaaatcttcagactgccagagatatacaggatatgcga
attaaaaagaaacaaaggcaacgtatttttccacagccaggtagtctgtatcttgcaaaa
acatccactatgcctagaatctctctgaaagtagcagtagaaggccgagtccccactgca
tgttctcataaacagctatataggtacggtgtttctaaacattgtgtaaaaattaacagc
agaaatgcagagtcttttcagtttcacactcaggattattttggtaaggaaagtttatgg
gctggaaagggaatacagttggctgatggtggatggctcataccctccaatgatggaatg
gctggaaaagaagaattttatagagctctgtgtgacaccccaggtgtggatccaaagctt
atttctagagtttgggtctataatcattatagatggattatatggaaactggcagctatg
gaatttgcctttcctaaagaatttgctaatagatgcctaagcccagaaagggtacttctt
caactcaaatacaggtatgatatggaaattgatagaagcagaagatcagctataaaaaag
ataatggaaagggatgacacagctgcaaaaacgcttgttctctgtgtttctgaaataatt
tcattaagcacaaatatatctgaaacttccagcagtaaaactaatagtatggataccaca
aaagtggccgttgtcgaacttacagatggatggtatgctattaaggcccaggtggatcct
cccctcttagctctcttaaagaacagtagactaactgtgggtcagaagatcataattcac
ggagcagagctggtgggctctcctgatgcctgtacgcctcttgaagccccagaatctctt
atgttaaagatttctgctaacagtactcggcctgcttgctggtatgccaaactcggattc
ttttccaatcctagaccttttcctcttcccttgtcatcacttttcagcgatggaggaaat
gttggttgtgttgacataattattcaaagagcataccctatacagtggatggagaagaca
tcatctggattatacatatttcgcaatgaaagagaagaagaaaaggaagcaacaaaatat
gcagaagcccaacaaaagaaactggaagccctgttcactaaaattcaagcagaatttgaa
gagcatgaagaaaatataacagaacgatgtataccatcacgtgcactaacaagacagcaa
gtccatgctctgcaagatggtgcagaactttatgaagctgtgaaggattcaccagatcca
agttaccttgagggttattttagtgaagagcagttacgagccttgaataatcacagacag
acgttaaatgataagaagcaagcccagatccatgtggaactcaggaaggctatggagtct
gctgagcaaggggaacagattttaccaagagacgttacacctgtgtggaagctgcgtatc
acgagctgtaagagaaaggaaaaagattcagttgtgttgagtatctggcgtccatcatca
gatttatattctctcttaacagagggaaagagatacagaatctatcatcttgcagcatca
aaatctaaaagtaaatccaaaagagctaacatacagttaacagcaacaaaaaaaacgcag
tatcaacaactaccggcttcagatgaaattctattacaagtttatcagccaagggagctg
cttcacttcaacaaattattggatccagacttccagccaccttgttctgaggtggaccta
ataggatttgtagtttctgttgtgaaaaaaataggtcttgctcctttggtctatttatca
gatgaatgccataatttattggcaataaagttttggatagatcttaatgaagacattatt
aaacctcacatgttaattgctgcaagcaacctccagtggctaccagagtccagatcagga
attcctactttatttgctggagatttttccatgttttctgccagtccaaaggagggccat
tttcgagaaacgttccacaaaatgaaaaatactattgagaatatcgatatattttgcaat
gatgcagaaaacaagcttattcgtatacttaatacaaataatcccaagtggtccaccccg
actaaagactatacttcagcaccacacactgctcaaacagtccttggtacaggaaataag
tttctgatgtcttctcccagtagtgagatggattatgaaagtccgttatcactttgtaag
ctaaaagggaagtctgtctccacacctgcagcagcccaaatgacttcaaagtcttgttgc
aaaggggagaaagagactgatgacccaaaaacctgcaaaaagagaagagccttggatttc
ttgagcagattgcctgtacctccacctgttagtcccatttgtacatttgtttctccagct
gcacagaaggcatttcagccaccacggagttgtggcaccaaatatgaaacacctatgaag
aaaaaagaattgaattctcctcagatgactccacttaaaaaatttaatgacatctctctt
ttggaaggtgattcaatagctgatgaagaacttgccctgataaatacccaagcccttttg
tctggttcagcaggagaaaatcaacttaaatctatcagtgagtccactaggactactccc
actggtccaaaagattatctcagactgaaaaggccttacactgcatctgtgatcaaagaa
caagggaattccccagccgggactgaagaacagaaggctaatatgcaggacacaagtaca
atgaaaactacatccaagagactgcaaaggcgacaaaaaccaaaatga

DBGET integrated database retrieval system