KEGG   Delphinapterus leucas (beluga whale): 111183039
Entry
111183039         CDS       T05885                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04010  MAPK signaling pathway
dle04014  Ras signaling pathway
dle04015  Rap1 signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04390  Hippo signaling pathway
dle04810  Regulation of actin cytoskeleton
dle05200  Pathways in cancer
dle05218  Melanoma
dle05224  Breast cancer
dle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111183039 (FGF1)
   04014 Ras signaling pathway
    111183039 (FGF1)
   04015 Rap1 signaling pathway
    111183039 (FGF1)
   04390 Hippo signaling pathway
    111183039 (FGF1)
   04151 PI3K-Akt signaling pathway
    111183039 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111183039 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111183039 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    111183039 (FGF1)
   05218 Melanoma
    111183039 (FGF1)
   05224 Breast cancer
    111183039 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111183039 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111183039 (FGF1)
Cytokines and growth factors [BR:dle04052]
 Growth factors
  Growth factors (RTK binding)
   111183039 (FGF1)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   111183039 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 111183039
NCBI-ProteinID: XP_022445702
UniProt: A0A2Y9PQS4
LinkDB
Position
Unknown
AA seq 189 aa
MSEVCCSTEDFEALWGKKPIASSLESAITRSCSAMAEGEITTFTALTEKFNLPPGNYKKP
KLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDG
LLYGSQTPNEECLFLERLEENHYNTYASKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAIL
FLPLPVSSD
NT seq 570 nt   +upstreamnt  +downstreamnt
atgagtgaagtttgctgctcaaccgaagacttcgaggctctgtggggaaaaaagcctatt
gccagcagccttgaaagcgccataaccaggagctgctcagccatggctgaaggggaaatc
acaaccttcacagccctgaccgagaagtttaatctgcctccagggaattacaagaagccc
aaactcctctactgtagcaacgggggccacttcctgaggatccttccagatggcacagtg
gatgggacaagggacaggagtgaccagcacattcagctgcagctcagtgcggaaagcgtg
ggggaggtgtatataaagagtacggagactggccagtacttggccatggacaccgacggg
cttttgtacggctcacagacacccaatgaggaatgtttgttcctggaaaggttggaggaa
aaccattacaacacctacgcatccaagaagcatgcagaaaagaattggttcgttggtctc
aagaagaacggaagctgcaaacgcggtcctcggactcactacggccagaaagcaatcttg
tttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system