KEGG   Delphinapterus leucas (beluga whale): 111183434
Entry
111183434         CDS       T05885                                 

Gene name
SIRT1
Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-1 isoform X1
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle00760  Nicotinate and nicotinamide metabolism
dle01100  Metabolic pathways
dle04068  FoxO signaling pathway
dle04152  AMPK signaling pathway
dle04211  Longevity regulating pathway
dle04213  Longevity regulating pathway - multiple species
dle04218  Cellular senescence
dle04922  Glucagon signaling pathway
dle05031  Amphetamine addiction
dle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    111183434 (SIRT1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111183434 (SIRT1)
   04152 AMPK signaling pathway
    111183434 (SIRT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    111183434 (SIRT1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111183434 (SIRT1)
  09149 Aging
   04211 Longevity regulating pathway
    111183434 (SIRT1)
   04213 Longevity regulating pathway - multiple species
    111183434 (SIRT1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    111183434 (SIRT1)
  09165 Substance dependence
   05031 Amphetamine addiction
    111183434 (SIRT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dle03036]
    111183434 (SIRT1)
   03029 Mitochondrial biogenesis [BR:dle03029]
    111183434 (SIRT1)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     111183434 (SIRT1)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     111183434 (SIRT1)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111183434 (SIRT1)
SSDB
Motif
Pfam: SIR2 DUF592
Other DBs
NCBI-GeneID: 111183434
NCBI-ProteinID: XP_022446410
UniProt: A0A2Y9PKW1
LinkDB
Position
Unknown
AA seq 735 aa
MADEAALAFQPGGSPSAVTAEREAPSPPAGEPLRKRPRRDGPGVGRSPGEPGGAAPEREL
PAAAGGCPAAALRREAQAAAAGEGDNGPGLQGLSREAPPADDFYDDDDDDDDDDEGEEEE
EAAAAIGYRDNLLFGDEIITNGFHSCESDEDDRASHASSSDWTPRPRIGPYTFVQQHLMI
GTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECK
KIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAK
EIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLIC
KYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVD
LLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLG
GEYAKLCCNPVKLSEITEKPPRTQKELAHLSELPPTPLNISEGSSSPEGTSPADSSVIVT
LLDQETKSNVDDPDASESKNCVEEKLQEVQTSARSIESVNEQLESPDLKNVASNTGEKNE
RTSVAETVRKCWPARLAKEQISKRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCG
SNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDDADVNERAGATGFGADGGDQEAVNEATS
MKQEATCINYPSNKS
NT seq 2208 nt   +upstreamnt  +downstreamnt
atggcggacgaggcggcgctcgcctttcagcccggcggctccccctcggcagtgacggct
gagagggaggccccgtcgcctcctgccggggagccgctccgcaagaggccgcggagagac
ggccccggcgtcgggcggagcccgggcgagcccggcggggcggcccccgagcgtgagctg
ccggcggcggccggcggctgcccggcggcggcgctgcggcgggaggcccaggcggcggcg
gccggagaaggagacaatgggccgggtttacagggcctatcccgggaggcgccgccggcc
gacgacttctacgacgacgacgacgacgacgacgacgacgacgagggcgaggaggaggaa
gaggcggcggcggctattgggtaccgagataatctactgtttggtgatgaaatcatcacc
aacggtttccattcgtgtgaaagtgatgaggatgatagagcctcacatgcgagttctagt
gactggactccaagaccacggataggtccatatactttcgttcagcaacatctcatgatt
ggcacagatcctcgaacgattcttaaagatttactaccagaaacaattcctccacctgaa
ttggatgatatgacactgtggcagattgttattaatatcctttcagaaccaccaaaaagg
aaaaaaagaaaagatattaatacaattgaagatgctgtgaaattactgcaagagtgcaaa
aaaataatagttctaactggagctggggtttctgtttcttgtggaatacctgacttcagg
tcaagagatggtatttatgctcgccttgcagtagactttccagaccttccagatcctcaa
gcaatgtttgacattgaatatttcagaaaagatccaagaccattcttcaagtttgcaaag
gaaatatatcctggacaattccaaccatctctttgtcacaaattcatagccttgtcagat
aaggaaggaaaactacttcgcaactatactcagaacatagatacactggaacaggttgca
ggaatccaaaggataattcagtgtcatggttcctttgcaacagcatcttgcctgatttgt
aaatacaaagttgactgtgaagctgtacgaggagatatttttaatcaggtggttcctcga
tgtcctaggtgcccagctgatgaaccacttgctatcatgaaaccagagattgtctttttt
ggtgaaaatttaccagaacagtttcatagagccatgaagtatgacaaagatgaagttgat
cttctcattgttattgggtcttccctgaaagtaagaccagtagcactaattccgagttcc
ataccccatgaagtgcctcagatattaattaatagggaacctttgcctcacctgcatttt
gatgtagagcttcttggagactgtgatgtcattattaatgaattgtgtcacaggttaggt
ggtgaatacgccaaactttgctgcaaccctgtaaagctttcagaaattactgaaaaacct
ccacgaacacaaaaagaattggctcacttgtcagagttgccacccacacccctcaatatt
tcagaaggctcaagttcaccagaaggaacctcaccagcagattcttcagtgattgtcact
cttttagaccaagaaacaaagagtaatgttgatgatccagatgcatctgaatcaaaaaac
tgtgttgaagaaaaattacaggaagtacagacttctgctaggagcattgaaagtgttaat
gaacagttggagagtccggatttgaagaatgttgcctccaatactggggagaaaaatgaa
agaacttcagttgctgaaacagtgagaaaatgctggccagctagactcgcaaaggagcag
attagtaaacggcttgatggtaatcaatatctgtttttaccaccaaaccgttatattttc
catggtgctgaggtatattcagactctgaagatgatgtcttatcctctagttcttgtggc
agtaacagtgatagtggaacatgccagagtccaagtttagaagaacctatggaggatgaa
agtgagattgaagaattttacaatggtttggaagatgatgctgatgttaatgagagagcc
ggagcaactggatttggagctgatggaggtgatcaagaggcagttaatgaagctacatct
atgaaacaggaagcaacatgcattaactatccatcgaacaaatcataa

DBGET integrated database retrieval system