KEGG   Delphinapterus leucas (beluga whale): 111184203
Entry
111184203         CDS       T05885                                 

Gene name
RBL1
Definition
(RefSeq) retinoblastoma-like protein 1 isoform X1
  KO
K04681  retinoblastoma-like protein 1
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04110  Cell cycle
dle04218  Cellular senescence
dle04350  TGF-beta signaling pathway
dle05165  Human papillomavirus infection
dle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111184203 (RBL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111184203 (RBL1)
   04218 Cellular senescence
    111184203 (RBL1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111184203 (RBL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    111184203 (RBL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111184203 (RBL1)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    111184203 (RBL1)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 ATLF
Other DBs
NCBI-GeneID: 111184203
NCBI-ProteinID: XP_022448174
UniProt: A0A2Y9PMP4
LinkDB
Position
Unknown
AA seq 1068 aa
MDEDDPHSEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVIHWLA
CSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRE
RIERLERNFEVSTVIFKKFEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKELFNFCWTL
FVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRRDLLNPSFKGLPSDFHTADFR
ASEEPPCIIPVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSK
AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTGDAPLGKLTAQANVECNLQQHFE
KKTSFAPSTPLTGRRYLREKEAVITPVASATQSVSRLQSIVAGLKNAPSEQLINIFGSCM
RNPMENIMKTVKLIGQTFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQET
RRLHGMDMSVLLEQDIFHHSLMACCLEIVLFAYSSPRTFPWIIQVLNLRPFYFYKVIEVV
IRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQASTNRVPTCEEVIFPNNFETG
NGGNVQGHLPMMPMSPLMHPRVKEVRTDSGSLRKDTQPLSPISVHERYSSPTAGSAKRRL
FGEDPPKEMLMDRIITEGTKLKIAPSSSITAENISISPGQSLLTMATAIVTGTTGHKVTI
PLHGIANDAGEITLIPISMNTTQESQVESPVSLTAQSLIGASPKQTHLTKAQEVHSVGIS
KPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHL
DQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVTYNKNLNG
DFEMTDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLSNQDHVMEA
PPLSPFPHIKQQPGSPRRISQQHSIYVSPHKNGSGLTPRSALLYKFNGSPSKSLKDINNM
IRQGEQRTKKRAIAIDGDAESPAKRLCQENDDILLKRLQDVVSERANH
NT seq 3207 nt   +upstreamnt  +downstreamnt
atggacgaggacgatccccactctgagggggcggcggtggtcgccgcggccggggaggcg
ctgcaggccctgtgccaggagctgaacctggatgaggggagcgcggccgaagccctggac
gacttcaccgccatccggggcaactacagcctagagggagaagttatacactggttggca
tgttcattatatgttgcttgccgcaaaagcattattcccacagttggaaagggtatcatg
gaaggaaattgtgtttcacttaccagaatactacgttcagctaaattaagtttaatacag
ttttttagtaaaatgaagaagtggatggacatgtcaaacttgccacaagaatttcgtgaa
cgtatagaaaggctagaaagaaattttgaggtgtctactgtaattttcaaaaaatttgag
ccaatttttttagatatatttcaaaatccatatgaagagccaccaaagttaccacgaagc
aggaagcagaggaggattccttgcagtgttaaggagctctttaatttctgttggacactc
tttgtttatactaagggtaattttcgtatgattggagatgatttagtaaactcttatcat
ttacttctgtgctgcttggatctgatttttgccaatgccattatgtgcccaaatagacga
gacttgctaaatccgtcatttaaaggtttaccatctgatttccatactgctgactttagg
gcttctgaagaacctccctgcatcattcctgtactgtgtgaactacatgacggacttctg
gtagaagccaaaggaataaaggagcactactttaagccatatatttcaaagctctttgac
aggaagattttaaagggagaatgccttctggacctttctagttttactgataatagcaaa
gcagtgaacaaggagtatgaagaatatgttttaactgttggtgactttgatgagaggatc
tttttgggagcagatgcagaagaggaaattggaactcctcgaaagttcactggtgatgcc
ccattagggaaactgacagcacaggctaatgtggagtgtaaccttcaacaacactttgaa
aaaaaaacatcatttgcaccttctacaccactgacaggacgacgatatttaagagaaaaa
gaagcagtcattactcctgttgcttcagccacccaaagtgtgagccggttacagagtatt
gtggccgggctgaaaaatgcaccaagtgaacaacttataaacatttttgggtcttgtatg
cgtaatcctatggaaaacattatgaaaacagtgaaactaataggacagactttctgccaa
cactatacccaatcaacagatgaacagccaggatctcacatagattttgctgtaaacaga
ctaaagcttgcagaaattttgtattataaaatattagagactgtaatggttcaggagaca
cgaagacttcatggaatggacatgtcagttcttttagagcaggatatatttcatcattcc
ttgatggcctgttgtttggaaattgtgctctttgcctatagctcacctcgtacttttccc
tggattattcaagttcttaatctgcgaccattttatttttataaggttattgaggtggtg
atccgctcagaggaaggactctccagggacatggtgaaacacctgaacagcattgaagaa
cagattttggagagtttagcatggagtcatgattctgcgctgtgggaggctctccaggct
tctacaaacagagttcctacctgtgaagaagttatattcccaaataattttgaaacagga
aatgggggaaatgtacagggacatcttcccatgatgccaatgtctcctctaatgcatcca
agggtcaaagaagttcggactgacagtgggagtcttcgaaaggatacgcaaccattgtct
ccaatttctgtccatgaacgctacagttctcctaccgctgggagtgctaagagaagactt
tttggggaagaccccccaaaggaaatgcttatggacaggatcataacagaaggaacaaaa
ttgaaaattgctccttcttcaagcattactgctgaaaatatatcaatttcacctgggcaa
agtcttctaacaatggccacagccatagtaacagggacaacaggacataaagttacaatc
ccattgcatggtattgcaaatgatgctggagagatcacactgataccaatttccatgaat
acaactcaggagtcccaagtcgagagtcctgtatcacttacggctcagtcattaattggt
gcttctccaaaacagacccatttgactaaagcacaagaggtacattcagttggaataagc
aaaccaaagagaactgggtccttagcactgttttatagaaaggtctatcatttggcaagt
gtacgcttacgtgatttatgtttaaaactggatgtttcaaatgagttaagaaggaagata
tggacatgttttgaattcactttagttcactgccctgatctgatgaaagacagacatttg
gatcagctcctcctttgtgccttttacatcatggcaaaggtaacaaaagaagaaagaact
tttcaagaaataatgaaaagttataggaatcagcctcaagctaatagtcatgtttacaga
agtgtactgttgaaaagtattccaagagaagttgtgacatacaataaaaacctaaatggt
gattttgaaatgacagattgtgatttggaagatgctacaaaaacacctgactgttccagt
ggaccagtgaaagaggaaagaggtgatcttatcaaattttacaacacaatatatgtagga
agagtgaagtcatttgcactgaaatacgacttgtcaaatcaggaccatgtgatggaagct
ccaccactctctccttttccacatattaagcaacagccaggctctccgcgccgcatttcc
cagcagcactccatttatgtgtccccacacaagaatgggtcaggccttacaccaaggagt
gctctgctctataagttcaatggcagcccttctaagagtttgaaagatatcaacaacatg
ataaggcaaggtgagcagagaaccaagaagcgagcaatagccatcgatggtgatgcagaa
tcacctgccaaacgcctctgtcaagaaaatgatgacattttacttaaacgactacaggat
gttgtcagtgaaagagcaaatcattag

DBGET integrated database retrieval system