KEGG   Delphinapterus leucas (beluga whale): 111185248
Entry
111185248         CDS       T05885                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04024  cAMP signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04310  Wnt signaling pathway
dle04330  Notch signaling pathway
dle04350  TGF-beta signaling pathway
dle04520  Adherens junction
dle04630  JAK-STAT signaling pathway
dle04720  Long-term potentiation
dle04916  Melanogenesis
dle04919  Thyroid hormone signaling pathway
dle04922  Glucagon signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05016  Huntington disease
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05206  MicroRNAs in cancer
dle05211  Renal cell carcinoma
dle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111185248 (CREBBP)
   04330 Notch signaling pathway
    111185248 (CREBBP)
   04350 TGF-beta signaling pathway
    111185248 (CREBBP)
   04630 JAK-STAT signaling pathway
    111185248 (CREBBP)
   04066 HIF-1 signaling pathway
    111185248 (CREBBP)
   04068 FoxO signaling pathway
    111185248 (CREBBP)
   04024 cAMP signaling pathway
    111185248 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111185248 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111185248 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111185248 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    111185248 (CREBBP)
   04919 Thyroid hormone signaling pathway
    111185248 (CREBBP)
   04916 Melanogenesis
    111185248 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    111185248 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111185248 (CREBBP)
   05206 MicroRNAs in cancer
    111185248 (CREBBP)
   05203 Viral carcinogenesis
    111185248 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    111185248 (CREBBP)
   05215 Prostate cancer
    111185248 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    111185248 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111185248 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111185248 (CREBBP)
   05161 Hepatitis B
    111185248 (CREBBP)
   05164 Influenza A
    111185248 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111185248 (CREBBP)
   05165 Human papillomavirus infection
    111185248 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111185248 (CREBBP)
   03036 Chromosome and associated proteins [BR:dle03036]
    111185248 (CREBBP)
   03029 Mitochondrial biogenesis [BR:dle03029]
    111185248 (CREBBP)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     111185248 (CREBBP)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    111185248 (CREBBP)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    111185248 (CREBBP)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    111185248 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 111185248
NCBI-ProteinID: XP_022450446
UniProt: A0A2Y9PZ76
LinkDB
Position
Unknown
AA seq 2442 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLLNSGNLV
PDAASKHKQLSELLRGGSSSSINPGIGNVSSSSPVQQGLGGQAQGQPNSANMASLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLMNPAQQGQAQVMNGSLGAAGRGRGAGMPYATPAMQGAASSVLA
ETLTQVSPQMAGHAGLNTAQAGGMSKMGMTGNTSPFGQPFSQTGGQQMGAPGVNPQLPSK
QSMVNSLPPFAADIKNASVTNVPNMSQMQTSVGIGPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLINDGSNSGNIGTLSTISTAAPPSSTGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGTQPPGIPQAQPVRPPNGPMPLPVNRMQVSQG
MNSFNPISLGNVQLPQAPMGPRASSPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGTHA
NNMMAQAPAQNQFLPQNQFPSSSGALNVNSVGMGQPAAQASVSQGQVPGAALPNPLNMLG
PQASQLPCPPVTQSPLHQTPPPASTAAGMPSLQHPAASGMTPPQPAAPTQPSTPVSSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPP
GTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPMLEMKAEVKTEDTEPDASEPKAEP
GAAIMEEDLQGSSQVKEETDTTEQKSEPMEVDEKKPEVKVEAKEEEESSTNGTASQSTSP
SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQ
PQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGR
TRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKS
RFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSI
HFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDL
SQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWE
FSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKS
HTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQK
MKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQH
RLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMS
PAGFPSVARTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNI
NNGMPPGRTGMVTPVSQMAPVGLNVPRPNQVSGPVVPNLPPGQWQQAPIPQQQPMPGMPR
PVMSMQAQPAVAGPRMPSVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLM
AAFIKQRTAKYVASQPGLQPQPGLQPQPGLQPQPGLHQQPSLQNLNAMQAGGPRPGVPPQ
QPAMGGLNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQGSA
GMAGGMAGHGQFQQPQGPGGYPAAMQQQRMQQHLPIQGSSMGQMAAQMGQLSQMGQPGLG
SDSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLS
SQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHL
GNPEQNAMLPQLNTPNRSALSNELSLVGDTTGDTLEKFVEGL
NT seq 7329 nt   +upstreamnt  +downstreamnt
atggccgaaaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgcca
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cccgatgagctgatccccaatggaggagaattaggccttttaaacagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcagagcttctgcgaggaggcagcagctct
agtatcaacccaggaataggaaatgtgagctccagcagccccgtgcaacaaggcctcgga
ggccaggcccaggggcagccgaacagtgcaaacatggccagtctgggtgccatgggcaag
agccctctgaaccagggagattcttcagcccccagccttcccaaacaggcagccagcacc
tctgggcccactccccctgcttcccaagcactgaatcctcaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacgtcacagacaggacctggtatctgcatgaatgctaat
tttaaccagacccacccaggcctcctcaatagtaactctggccatagtttaatgaacccg
gcccagcaagggcaggcgcaagtcatgaatggatctcttggggctgctggcagaggaagg
ggagctggaatgccatacgctactccggccatgcagggggccgcgagcagcgtgctggct
gagacgttaactcaagtttcaccgcaaatggccggccatgcaggactgaacacagcgcaa
gccggaggcatgagcaagatgggaatgactggtaacacaagtccatttggacaacccttt
agtcaaactggagggcagcagatgggagcccctggagtgaaccctcagctgcccagcaag
cagagcatggtcaatagcttgcctcccttcgctgcagacatcaagaatgcttcagtcacc
aacgtgccaaacatgtctcagatgcaaacatcagtgggaattggacccacacaggcaatt
gcaacgggccctactgcagatcctgaaaaacgcaaactgatacagcagcagctggttcta
ctgcttcacgctcataaatgtcagaggcgagaacaagcaaatggagaggttcgggcctgc
tctctcccacattgtcgaaccatgaaaaatgttttgaatcacatgacacattgtcaggct
gggaaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtggaattcaaaacacaattggttctgtt
ggcacaggccaacagaatgccacttctttaagtaacccaaatcccatagaccccagctcc
atgcaacgagcgtatgctgctcttggactcccctacctgaaccagccccagacgcagctg
cagcctcaggttcctggccagcaaccagcacagcctcaaactcaccagcagatgaggact
ctcaaccccttgggaaataacccaatgaacattccagcaggaggaataacaacagatcag
cagccaccaaacttgatttcagaatcagctcttccaacttcccttggggccacaaaccca
ctgatcaatgacggctcaaactctggaaacattggaaccctcagcactatatccacagca
gcacctccttccagcactggcgttcggaaaggctggcacgaacatgtcactcaggacctg
cggagccatctagtgcataaacttgtccaagccatcttcccaacacctgaccctgcagcc
ctgaaggatcgccgcatggagaacctggtggcctacgctaagaaagtggaaggggacatg
tatgagtctgccaacagcagggatgagtactatcacttactagcagagaaaatctacaag
atacaaaaagaactagaagaaaaacggagatcgcgtttacacaaacaaggcatcttgggt
aaccagccagccttaccagcccccgggacacagcctcctgggataccacaggcacagcct
gtgagacctccaaatgggcccatgcctctgccagtgaatcgcatgcaggtttctcaaggg
atgaattcatttaacccaatatccttggggaatgtacagttgccacaagctcccatggga
cctcgtgcatcgtcccccatgaaccactctgtcccgatgaacagcatgggctccgttcca
gggatggccatttctccttcccgaatgcctcagcctccgaacatgatgggtacacacgcc
aacaacatgatggcccaggcacctgcccagaaccagttcctgccacagaaccagttcccg
tcctccagcggggcgctgaacgtgaacagcgtgggcatggggcagccagcggcccaggcc
agcgtgtcacagggacaggtgcctggtgctgctcttcctaaccctctgaacatgcttggg
ccccaggccagccagctgccttgcccaccagtgacacagtcaccgttacaccagactcca
cctcctgcttccacggccgcaggcatgccgtctcttcagcatccggcggcatctgggatg
actcctccccagccagcagctcccacccagccatcaactcctgtgtcgtcttccgggcag
actcccaccccgactcccggctcagtgcccagtgccagccaaacccagagcacccctaca
gtccaggcggcagcccaggcccaggtgaccccacagcctcagaccccagtccagcctcca
tccgtggccacccctcagtcgtcacagcagcagccgacacctgtgcacacccagcctcct
ggcacaccgctttcccaggcagcagccagcattgataacagggtccccactccatcctca
gtggccagcgccgaaaccaactcccagcagccaggacccgatgtaccaatgctggaaatg
aaggctgaggtcaagactgaggacaccgagcccgatgccagtgaacccaaagcagagcct
ggggctgcgatcatggaggaggacttacaaggatcttctcaagttaaagaagaaacagac
acaacagagcagaagtcggaaccaatggaagtggatgaaaagaaacctgaagtgaaagtc
gaagctaaagaggaagaagagagtagcaccaacgggacagcctcacagtccacttctcct
tctcagcctcgcaaaaaaatctttaagccggaggagttgcgccaggctctgatgccaacc
ctagaagcgctgtatcgacaggatccagagtccctaccttttcggcagcctgtagatccc
cagctcctaggaattccagattattttgacattgtgaagaatcccatggacctttccacc
atcaagcggaagctggatacagggcagtaccaggaaccctggcagtatgtggatgacgtc
tggctcatgttcaacaatgcctggctctacaatcggaagacatcccgggtctataagttc
tgcagtaagctcgcagaggtctttgagcaagaaattgaccctgttatgcaatcccttgga
tattgctgtggacgcaagtatgagttttccccacagactttgtgctgctacgggaagcag
ctgtgtacaattcctcgtgatgctgcctactacagctatcagaataggtatcatttctgt
gagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacaa
ccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcct
gaacctttcgttgattgcaaggagtgtggccggaagatgcatcagatttgtgttctccac
tatgatatcatttggccttcaggctttgtgtgtgacaactgcttgaagaaaacgggcaga
actcgtaaagaaaacaaattcagtgctaagagactgcagaccacacggttgggaaaccac
ttggaagaccgagtcaacaagtttttgcggcgacagaatcatcctgaagccggggaggtg
tttgtccgtgtagtggccagctcagacaagacggtggaagtcaagcccgggatgaagtca
cggtttgtggattctggggaaatgtctgaatctttcccgtatcgaaccaaagcactcttt
gcctttgaggaaattgatggagtggacgtgtgcttctttgggatgcatgtccaagagtat
ggctctgattgcccccctccaaacacaaggcgtgtgtacatatcttatctggacagtatt
catttcttccgaccgagatgcctccgaacagctgtttaccatgagatccttattggatat
ttagagtacgtgaagaaattggggtatgtaacaggacacatctgggcctgtcccccaagt
gaaggagacgactacatcttccattgccaccccccagatcaaaaaatccccaagccaaag
cgcctgcaggagtggtacaagaagatgctggacaaggcctttgccgagcgcatcatccat
gactataaggacattttcaaacaagcaactgaagacaggctcaccagtgccaaggaactg
ccttatttcgagggtgacttctggcctaacgtgttggaggagagcattaaggagctggaa
caggaggaagaagagaggaagaaggaggagagcaccgcggccagtgagaccccggagggc
agccagggcgacagcaagaacgccaagaaaaagaacaacaagaaaaccaacaagaataaa
agcagcatcagccgagccaacaagaaaaagcccagcatgcccaacgtgtccaacgacttg
tcccagaagctctatgccacgatggagaagcacaaagaggtcttctttgtgatccacctc
cacgctgggcccgtcatcaacacgctgccccccatcgtcgaccccgaccccctgctcagc
tgtgacctcatggacgggcgggacgccttcctcacgctggcccgggacaagcattgggag
ttctcctccctgcggcgctccaagtggtccacgctgtgcatgctggtggagctgcacacc
cagggccaggaccgcttcgtctacacctgcaatgagtgcaagcaccacgtggagacgcgc
tggcactgcaccgtgtgcgaggactatgacctctgcatcaactgctacaacacgaagagc
cacacccacaagatggtgaagtgggggctgggcctggacgacgagggcagcagccagggt
gagccacagtccaagagcccccaagagtcacggcgcctgagcatccagcgctgcatccag
tccctggtgcacgcctgtcagtgccgcaacgccaactgctcactgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggttgcaagcgcaagaccaacggcggctgccca
gtgtgcaagcagctcattgccctctgctgctaccacgccaaacactgccaagaaaacaag
tgccccgtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcac
cgcctgcagcaggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtg
cctcagcagagcctaccttcccctacctcagcaccacccgggacccccacgcagcagccc
agcacgccccagacgccacagccccccgcccagccgcagccctcgcccgtgaacatgtca
ccagccggcttccccagtgtggcccggactcagccccccacaacggtgtccaccgggaag
cccaccaaccaggtgccagccccaccaccccccgcccagcccccacccgcggcagtggag
gcggcccggcagatcgagcgggaggcccagcagcagcagcacctgtaccgggtgaacatc
aacaacggcatgcccccagggcgcacgggcatggtgaccccggtgagccagatggccccc
gtgggcctgaacgtgccccgacccaaccaggtcagcgggcccgtcgtgcccaacctgcca
cctgggcagtggcagcaggcgcccatcccccagcagcagccgatgccaggcatgccgaga
cccgtgatgtccatgcaggcccagccggccgtggccgggccacggatgcccagcgtgcaa
ccgccccggagcatctcgcccggcgccctgcaggacctgcttcggaccctgaagtccccc
agctccccacagcagcagcagcaggtgctcaacatcctcaagtccaatcctcagctgatg
gcagctttcattaaacaacgcacggccaagtacgtggccagtcagcccggcctgcagccc
caacctggcctgcagccccagcccggcctgcagccccagcccggcttgcaccagcagccc
agcctgcagaacctgaatgccatgcaagccggcgggccacggcccggtgtgcctcctcag
cagccggcgatgggcggcctgaacccccagggccaggccctgaacatcatgaacccgggg
cacaaccccagcatggcaagtatgaacccacagtacagagagatgctgcgaaggcagctc
ctgcagcagcagcagcagcagcagcagcaacagcagcagcagcagcagcagggcagtgcc
ggcatggccgggggcatggcggggcacggccagttccagcagcctcagggacccggaggc
taccccgcggccatgcaacagcagcggatgcagcagcacctccccatccagggcagctcc
atgggccagatggcagcccagatgggacagctcagccagatggggcagcctgggctgggc
tcagacagcacgcccaacatccagcaggccctgcaacagcggattctgcagcagcagcag
atgaagcagcagatcgggtccccgggccagccgaaccccatgagcccccagcagcacatg
ctctcaggacagccgcaggcctcgcacctccccggccagcagatggccacgtccctcagt
agccaggtgcggtctccggcccctgtccagtctccacggccccagtcccagcctccacat
tccagcccgtcgccacggatacagccccagccttcaccacaccacgtctcgccccagact
ggttccccccacccaggacttgcagtcaccatggccagctccatagatcagggacacttg
gggaaccccgaacagaatgcaatgctcccccagctgaacacccccaacaggagtgcgttg
tccaatgagctgtccctggtcggcgacaccacgggagacaccctagaaaagtttgtggag
ggtttgtag

KEGG   Delphinapterus leucas (beluga whale): 111186470
Entry
111186470         CDS       T05885                                 

Gene name
EP300
Definition
(RefSeq) histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04024  cAMP signaling pathway
dle04066  HIF-1 signaling pathway
dle04068  FoxO signaling pathway
dle04110  Cell cycle
dle04310  Wnt signaling pathway
dle04330  Notch signaling pathway
dle04350  TGF-beta signaling pathway
dle04520  Adherens junction
dle04630  JAK-STAT signaling pathway
dle04720  Long-term potentiation
dle04916  Melanogenesis
dle04919  Thyroid hormone signaling pathway
dle04922  Glucagon signaling pathway
dle04935  Growth hormone synthesis, secretion and action
dle05016  Huntington disease
dle05152  Tuberculosis
dle05161  Hepatitis B
dle05164  Influenza A
dle05165  Human papillomavirus infection
dle05166  Human T-cell leukemia virus 1 infection
dle05167  Kaposi sarcoma-associated herpesvirus infection
dle05200  Pathways in cancer
dle05203  Viral carcinogenesis
dle05206  MicroRNAs in cancer
dle05211  Renal cell carcinoma
dle05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111186470 (EP300)
   04330 Notch signaling pathway
    111186470 (EP300)
   04350 TGF-beta signaling pathway
    111186470 (EP300)
   04630 JAK-STAT signaling pathway
    111186470 (EP300)
   04066 HIF-1 signaling pathway
    111186470 (EP300)
   04068 FoxO signaling pathway
    111186470 (EP300)
   04024 cAMP signaling pathway
    111186470 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111186470 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    111186470 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    111186470 (EP300)
   04935 Growth hormone synthesis, secretion and action
    111186470 (EP300)
   04919 Thyroid hormone signaling pathway
    111186470 (EP300)
   04916 Melanogenesis
    111186470 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    111186470 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186470 (EP300)
   05206 MicroRNAs in cancer
    111186470 (EP300)
   05203 Viral carcinogenesis
    111186470 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    111186470 (EP300)
   05215 Prostate cancer
    111186470 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    111186470 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111186470 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111186470 (EP300)
   05161 Hepatitis B
    111186470 (EP300)
   05164 Influenza A
    111186470 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    111186470 (EP300)
   05165 Human papillomavirus infection
    111186470 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dle03000]
    111186470 (EP300)
   03036 Chromosome and associated proteins [BR:dle03036]
    111186470 (EP300)
   03029 Mitochondrial biogenesis [BR:dle03029]
    111186470 (EP300)
Enzymes [BR:dle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     111186470 (EP300)
Transcription factors [BR:dle03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    111186470 (EP300)
Chromosome and associated proteins [BR:dle03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    111186470 (EP300)
Mitochondrial biogenesis [BR:dle03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    111186470 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 111186470
NCBI-ProteinID: XP_022452845
UniProt: A0A2Y9Q5F4
LinkDB
Position
Unknown
AA seq 2420 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVSGPGQGMASQAQQNSPGLSLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSATGMMNSPVNQPGMGMNTGMNAGMNPGMLT
AGNGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQIGASGLGLQIPTKSVLPNSLSPFAMDKKAVPGGGM
PNMGQQQTPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMSENASVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAASMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQPGLNQFGQMS
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTN
MPLAPSGSQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQPALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPPTQLPPQVQP
SLPAAPSVDQAQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSS
TEVNSQAIPEKQPSQEVKMEAKMEVDAPEPADTQPEDIPETKAEDCKVEPTETEERGAEL
KTETKEEEDQPSTSAAQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRAGVVGQQQGLPSPTPATPTTPT
GQQPTTPQTPQPPSQPQPTPPASMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLP
GPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNAPPMARGPGGH
LEPGVGPTGMQQPPPWAQGGLPQPQHLQPGMPRPAMMSVSQHGQPLNMAPQPGLGQVGVS
PLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQP
LPGQPGVPQGQPGLQPPAMPGQQGVHSSPAMPNLNPMQAGVQRAGLPQQQAPQQQLPPPM
GGMSPQAPQMGMNPSTVPAQFRDLLRRQQMMQQQQQGAGPGVGPGLASHSQFQPAQGLGY
PAPQPPPPPPPPRMPQHLQHLQQGSGGQLGQLPPALGAEAGAGLQAYQQRLLQQQMGSPA
QPNPMSPQQHMLPSQAQSPHLPGQQIPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQ
PSPHHVSPQTSSPHPGLVAAQGNPMEQGHFASPDQNSMLSQLTSNPGMANLHGASATDLG
LSTDNSDLNSNLSQSTLDIH
NT seq 7263 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctatttgacttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacgagccttggcatggtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctacgttctggtagttcccctaacctcaacatgggggttagtggccca
ggccaaggcatggccagccaggcccaacagaacagtcctggattaagtttgataaatagc
atggtcaaaagcccaatggcacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcccacaccatctgcaacaggtatgatgaacagtccagtaaat
caacctggcatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttgact
gcaggcaatggacaagggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaatatgcagtacccaaacccaggcatgggaaatgctggcaacttaatg
actgagccactgcagcaaggctctccccagatgggaggacaaacaggattgagagggccc
cagcctcttaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagattggagccagtggccttggtctacagattccgacaaagtctgta
ctaccaaatagcttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaacatgggccagcagcagaccccgcaggtccagcagccaggcctggtgactccagtg
gcccaagggatgggttctggagcacacacagctgatccagagaagcgcaagctcatccag
cagcagcttgttctccttttgcacgctcacaagtgccagcggcgagagcaggccaatggg
gaagtgaggcagtgcaaccttccccactgtcgtacaatgaagaacgtccttaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgtcctgtgtgtctaccccttaaaaat
gctggagataagagaaatcaacagtcaattctgactggagcaccagttggacttggaaat
actagctctctaggggtgggtcaacagtctactcccagcctaagcactgttagtcagatt
gatcccagctctatagaaagggcttatgcagcccttggactaccctatcaagtaaatcag
atgccaacacagccccaggtgcaagcaaagaaccagcagaaccagcaatctggacagtct
ccccaggggatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaacgtcgaatcttctttctgactcgatgttgcattcagccataaattct
caaaacccaatgatgagtgaaaatgccagtgtggcctccctgggtcctatgccaacagca
gctcaaccatccagtactggaattcggaaacaatggcatgaagatattactcaggatctt
cgaaatcatcttgttcacaaacttgttcaagccatatttcctactccggatcctgctgct
ttaaaagacagacggatggaaaacctggttgcatatgcccggaaagtggaaggggacatg
tatgaatctgcgaacaatcgagcggaatactaccacctgctagctgagaagatctataag
atccagaaagaactggaagaaaaacgaaggactagactacaaaaacagaacatgctacca
agtgctgcaagcatggtgccagtttccatgaacccagggcctaacatggggcagccacaa
ccaggaatgacttctaatggccctctacctgatccatctatgatccgtggcagtgtgcca
aaccagatgatgcctcggataactccacaacctggtttgaatcaatttggccagatgagt
atgccccagccccctattggaccccggcaaacctctcctcttcagcaccatggacagtta
gctcaacctggaactctcaacccgcctatgggctatgggcctcgcatgcagcagccttcc
agccagagccagttccttcctcagactcagttctcaacacagggaatgaatgtaacaaat
atgcctttggctccgtctggcagtcaagcaccagtgtctcaagcacaaatgtccagttct
tcctgccctgtgaactctcctataatgcctcctgggtctcaagggagccacattcactgt
ccccctctccctcaaccagctctgcatcagaactcaccctcacctgtacctagtcgtacc
ccaacccctcaccacactcccccaagcataggggctcagcagccaccagcaacagcaatt
ccagcccctgttcctacacctccagccatgccacctgggccacagtcccaggctctacat
cctcctccaagacagacgcctacaccgccaccaacgcaacttcctccccaagtgcagcct
tcacttcctgctgctccttcagttgaccaggcgcagcagcagcctctgtcccagcagagt
acagcagcctctgtgcccaccccgacggcgccactgctgcctccgcagccggcaactcca
ctttcccagccagctgtaagcatcgaaggtcaggtatcaaaccctccatctactagtagc
acggaagtgaattctcaggccattcctgagaagcagccttcacaggaagtgaaaatggag
gctaaaatggaagtggatgcaccagaaccagcagatactcagccagaggatattccagag
actaaagcagaagactgtaaagtggaacctacagaaacagaagagagaggcgctgaatta
aaaactgaaacaaaagaggaggaagaccagccaagtacttcagcagcccagtcatctcca
gccccaggacagtcaaaaaagaagattttcaaacctgaagagctacgacaggcactgatg
ccgacattggaggcactttaccgacaggatccagaatcccttccctttcgtcaacctgtg
gacccccagctcctaggaatccctgattactttgatattgtgaagagccccatggatctt
tctactatcaaaaggaagttagacactggacagtatcaggagccctggcagtatgtggat
gacatttggcttatgttcaacaatgcttggttatataatcggaaaacatcacgggtgtac
aaatactgctccaagctgtctgaggtcttcgaacaagaaattgacccagtcatgcaaagc
cttggatactgctgtggcagaaagttggagttctctccacagacactctgttgctatggc
aaacagttatgcacaatccctcgtgatgccacttactacagttaccagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccagcctcaaactacaataaataaagaacaattttcgaagagaaaaaatgacactctg
gatcctgaactgtttgttgaatgtacggagtgtggaagaaagatgcatcagatctgtgtc
cttcatcatgagatcatctggccatctggatttgtctgtgatggctgtttaaagaagact
gcacgaactagaaaagaaaataagttttctgctaaaaggttgccatctaccaggcttggc
acctttctggagaatcgtgtgaatgactttctgaggcgacaaaatcaccctgagtcagga
gaggtcaccgttagagtagttcatgcttctgacaaaactgtggaagtcaaaccaggcatg
aaagcaaggtttgtagacagtggagagatggcagaatcctttccatatcgaacaaaagcc
ctctttgcctttgaggagattgatggtgttgacttgtgtttctttggcatgcacgttcaa
gagtatggttctgactgccccccgcccaaccagaggagagtatacatatcatacctggac
agtgttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaattctaatt
gggtatttggaatacgtcaagaaattaggatatacaacagggcatatttgggcatgcccc
ccaagtgaaggagacgactacatcttccattgccacccccccgaccagaagatacccaag
cccaagcgactgcaggagtggtacaaaaagatgctcgacaaggctgtatccgagcgaatt
gtccacgactacaaggatatttttaaacaagctactgaagatcgattaacaagcgcgaag
gaattgccttactttgaaggtgatttctggcccaatgtactggaagagagcattaaggaa
ctggaacaggaggaggaagagagaaagcgagaggagaacacgagcaacgaaagcacagat
gtgacaaagggagacagcaaaaatgctaaaaagaagaataataagaaaactagcaaaaac
aagagcagcctgagtaggggcaataagaagaagccaggcatgcccaatgtatccaatgac
ctctcgcaaaaactgtatgccaccatggagaagcataaagaggtcttctttgtgatccgt
ctcatcgccggccccgccgccaactccctgcctcccatcgttgatcccgaccccctcatc
ccctgcgacctgatggacgggcgggatgcctttctcaccctcgcaagggacaagcacctg
gagttctcctcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcac
acccagagccaggaccgcttcgtctacacctgcaatgagtgcaagcaccacgtggagacg
cgctggcactgcaccgtgtgcgaggattatgatttgtgtatcacctgctataacactaaa
aaccatgaccacaaaatggagaaacttggtctcgggctagatgacgagagcaacaaccag
caggccgcggccacccagagcccgggggattcccgccgcctgagcatccagcggtgcatc
cagtctctggtccacgcctgccagtgccgaaatgccaactgctccctgccctcctgccag
aagatgaagcgggttgtgcagcacaccaagggctgcaagcggaagaccaacggagggtgc
cccatctgcaagcagctcatcgccctctgctgctaccacgccaagcactgccaggagaac
aagtgccccgtgcccttctgcctcaacatcaagcagaagctccggcagcagcagctacag
caccggctccagcaagcccagatgctccgcaggaggatggccagcatgcagcgggctggc
gtggtggggcagcagcagggcctgccctccccgacgcctgcgaccccgaccacgcccacc
ggccagcaaccgaccaccccgcagacgccccagcccccctcccagccccagcccacccct
cccgccagcatgccgccctacttgcccaggactcaggctgctggcccggtgtcccagggc
aaggcagccggccaggtcacccccccgacccctccgcagactgctcagccacccctccca
ggaccccctcctgcagcggtggaaatggcgatgcagattcagagggcagccgagacgcag
cgccagatggcccatgtgcaaatttttcaaaggccgatccagcatcagatgccccagatg
actccgatggcccccatgggtatgaacgcaccccccatggccagaggtcccggcgggcat
ttggagccaggggtggggcccacagggatgcagcagccaccaccatgggcccaaggagga
ttgcctcagccccagcacctgcagcctgggatgcccaggccagccatgatgtcagtgtca
cagcatggtcagcccctgaacatggctccccaaccgggattgggccaggtaggtgtgagc
cctctcaaaccgggcactgtgtctcaacaagccttacaaaaccttctgcggactctcagg
tctcccagctcccccctgcagcagcaacaggtgcttagtatccttcacgccaacccccag
ctgttggctgcgttcatcaagcagcgggctgccaagtacgccaactccaatccgcagccc
ctccccgggcagcccggcgtgccccagggccagccagggctgcagccccccgccatgccg
ggccagcagggggtccactccagtcccgccatgccgaacttgaatcccatgcaggcgggc
gtccagagggccggcctgccgcagcagcaagcgccacagcagcagctcccgccgcccatg
gggggcatgagcccccaggctccgcagatgggcatgaatcccagcaccgtgccggcgcaa
tttcgggaccttctgaggcggcagcagatgatgcagcagcagcagcagggagcggggccg
ggagtcgggcctgggctggccagccacagccagtttcagccagcccagggcctgggctac
cctgccccccagccgccaccgccgccgccgccgccccggatgccgcagcacctgcagcac
ctgcagcaagggagcgggggccagctgggccagctccccccggccctgggggcggaggcc
ggagccggcctgcaggcctatcagcagcgcctccttcagcaacagatggggtcccctgct
cagcccaaccccatgagcccccagcagcacatgctcccgagtcaggctcagtccccgcac
cttccaggccagcagatcccatctctctccaatcaagtgcggtctccccagcctgttcct
tctccgcggccacagtcccagcccccccactccagcccttccccacggatgcagcctcag
ccttctccacaccacgtttccccacagaccagttctccacatcccggactggtcgctgcc
cagggcaaccccatggaacaagggcattttgccagcccggaccagaattcgatgctctct
cagctgactagcaatccaggcatggcaaacctccatggtgccagcgccacggacctggga
ctcagcaccgacaactcagacttgaattcaaacctctcacagagtacactagacatacac
tag

DBGET integrated database retrieval system