KEGG   Delphinapterus leucas (beluga whale): 111186150
Entry
111186150         CDS       T05885                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle04060  Cytokine-cytokine receptor interaction
dle04061  Viral protein interaction with cytokine and cytokine receptor
dle04151  PI3K-Akt signaling pathway
dle04625  C-type lectin receptor signaling pathway
dle04630  JAK-STAT signaling pathway
dle04658  Th1 and Th2 cell differentiation
dle04659  Th17 cell differentiation
dle04660  T cell receptor signaling pathway
dle04672  Intestinal immune network for IgA production
dle04940  Type I diabetes mellitus
dle05135  Yersinia infection
dle05142  Chagas disease
dle05162  Measles
dle05166  Human T-cell leukemia virus 1 infection
dle05200  Pathways in cancer
dle05320  Autoimmune thyroid disease
dle05321  Inflammatory bowel disease
dle05330  Allograft rejection
dle05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    111186150 (IL2)
   04151 PI3K-Akt signaling pathway
    111186150 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111186150 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    111186150 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    111186150 (IL2)
   04660 T cell receptor signaling pathway
    111186150 (IL2)
   04658 Th1 and Th2 cell differentiation
    111186150 (IL2)
   04659 Th17 cell differentiation
    111186150 (IL2)
   04672 Intestinal immune network for IgA production
    111186150 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111186150 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111186150 (IL2)
   05321 Inflammatory bowel disease
    111186150 (IL2)
   05330 Allograft rejection
    111186150 (IL2)
   05332 Graft-versus-host disease
    111186150 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111186150 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111186150 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111186150 (IL2)
   05162 Measles
    111186150 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    111186150 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:dle04052]
    111186150 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:dle00536]
    111186150 (IL2)
Cytokines and growth factors [BR:dle04052]
 Cytokines
  Interleukins
   111186150 (IL2)
Glycosaminoglycan binding proteins [BR:dle00536]
 Heparan sulfate / Haparin
  Cytokines
   111186150 (IL2)
SSDB
Motif
Pfam: IL2
Other DBs
NCBI-GeneID: 111186150
NCBI-ProteinID: XP_022452137
UniProt: A0A2Y9Q9K4
LinkDB
Position
Unknown
AA seq 154 aa
MYKMQLLSCIALTLALVANGAPTSSSTENTKKQVQSLLQDLHLLLKEINNYENLKLFRML
TFKFYMPKKATELKHLQCLAEELKPLEDVLNVAQSKTQNSIDIKDLMDNINRIVLTLKGS
ETRFTCEYDDETVTAVEFLNKWITFCQSIYSTMT
NT seq 465 nt   +upstreamnt  +downstreamnt
atgtacaagatgcaactcttgtcttgcattgcactaactcttgcacttgtggcaaacggt
gcacctacttcaagctctacagagaacacaaagaaacaagtgcagtcattgctgcaggat
ttacatttgcttttgaaggaaattaataattacgagaacctcaagctcttcaggatgctc
acatttaaattttacatgcccaagaaggctacagaattgaaacatcttcagtgtctagca
gaagaactcaaacctctggaggatgtgctaaatgttgctcaaagcaaaacccagaactcg
atagatatcaaggatttaatggacaatatcaacagaatagttttgacactaaagggatct
gaaacaagattcacatgtgaatatgatgatgagacagtaaccgctgtagaatttctgaac
aaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system