Delphinapterus leucas (beluga whale): 111186150 Help Entry 111186150         CDS       T05885                                  Gene name IL2 Definition (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism dle  Delphinapterus leucas (beluga whale) Pathway dle04060   Cytokine-cytokine receptor interaction dle04061   Viral protein interaction with cytokine and cytokine receptor dle04151   PI3K-Akt signaling pathway dle04625   C-type lectin receptor signaling pathway dle04630   JAK-STAT signaling pathway dle04658   Th1 and Th2 cell differentiation dle04659   Th17 cell differentiation dle04660   T cell receptor signaling pathway dle04672   Intestinal immune network for IgA production dle04940   Type I diabetes mellitus dle05135   Yersinia infection dle05142   Chagas disease dle05162   Measles dle05166   Human T-cell leukemia virus 1 infection dle05200   Pathways in cancer dle05320   Autoimmune thyroid disease dle05321   Inflammatory bowel disease dle05330   Allograft rejection dle05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:dle00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     111186150 (IL2)    04151 PI3K-Akt signaling pathway     111186150 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111186150 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     111186150 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111186150 (IL2)    04660 T cell receptor signaling pathway     111186150 (IL2)    04658 Th1 and Th2 cell differentiation     111186150 (IL2)    04659 Th17 cell differentiation     111186150 (IL2)    04672 Intestinal immune network for IgA production     111186150 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111186150 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     111186150 (IL2)    05321 Inflammatory bowel disease     111186150 (IL2)    05330 Allograft rejection     111186150 (IL2)    05332 Graft-versus-host disease     111186150 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     111186150 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     111186150 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     111186150 (IL2)    05162 Measles     111186150 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     111186150 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:dle04052]     111186150 (IL2)    00536 Glycosaminoglycan binding proteins [BR:dle00536]     111186150 (IL2) Cytokines and growth factors [BR:dle04052]  Cytokines   Interleukins    111186150 (IL2) Glycosaminoglycan binding proteins [BR:dle00536]  Heparan sulfate / Haparin   Cytokines    111186150 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 Motif Other DBs NCBI-GeneID:  111186150 NCBI-ProteinID:  XP_022452137 UniProt:  A0A2Y9Q9K4 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MYKMQLLSCIALTLALVANGAPTSSSTENTKKQVQSLLQDLHLLLKEINNYENLKLFRML TFKFYMPKKATELKHLQCLAEELKPLEDVLNVAQSKTQNSIDIKDLMDNINRIVLTLKGS ETRFTCEYDDETVTAVEFLNKWITFCQSIYSTMT NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgtacaagatgcaactcttgtcttgcattgcactaactcttgcacttgtggcaaacggt gcacctacttcaagctctacagagaacacaaagaaacaagtgcagtcattgctgcaggat ttacatttgcttttgaaggaaattaataattacgagaacctcaagctcttcaggatgctc acatttaaattttacatgcccaagaaggctacagaattgaaacatcttcagtgtctagca gaagaactcaaacctctggaggatgtgctaaatgttgctcaaagcaaaacccagaactcg atagatatcaaggatttaatggacaatatcaacagaatagttttgacactaaagggatct gaaacaagattcacatgtgaatatgatgatgagacagtaaccgctgtagaatttctgaac aaatggattaccttttgtcaaagcatctactcaacaatgacttga

DBGET integrated database retrieval system