KEGG   Delphinapterus leucas (beluga whale): 111187462
Entry
111187462         CDS       T05885                                 

Gene name
BCL2L11
Definition
(RefSeq) bcl-2-like protein 11 isoform X1
  KO
K16341  Bcl-2-like protein 11
Organism
dle  Delphinapterus leucas (beluga whale)
Pathway
dle01521  EGFR tyrosine kinase inhibitor resistance
dle04068  FoxO signaling pathway
dle04151  PI3K-Akt signaling pathway
dle04210  Apoptosis
dle04215  Apoptosis - multiple species
dle04932  Non-alcoholic fatty liver disease
dle05169  Epstein-Barr virus infection
dle05200  Pathways in cancer
dle05206  MicroRNAs in cancer
dle05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:dle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111187462 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    111187462 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111187462 (BCL2L11)
   04215 Apoptosis - multiple species
    111187462 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111187462 (BCL2L11)
   05206 MicroRNAs in cancer
    111187462 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    111187462 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    111187462 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    111187462 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    111187462 (BCL2L11)
SSDB
Motif
Pfam: Bclx_interact Bim_N
Other DBs
NCBI-GeneID: 111187462
NCBI-ProteinID: XP_022454894
UniProt: A0A2Y9Q748
LinkDB
Position
Unknown
AA seq 288 aa
MFPAAAVGVARTGDAACGALSCPAERGSGRAASCRLSAAPGAPTASPGLCLPGRLRVDGQ
GAPGRRRARAGRRRAPARTRRSEGKGRTKKDQMAKQPSDVSSECDREGGQLQPAERPPQL
RPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRS
SSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQ
ELRRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIVRLVWRMQ
NT seq 867 nt   +upstreamnt  +downstreamnt
atgttcccggcggctgcggtcggggtagcgcgtaccggagacgcggcgtgcggagccctc
agctgcccggcggagcgcggcagcggacgggcggcgagttgcaggctctccgctgccccg
ggcgctccgaccgcgagtcccgggctttgtctcccgggccgccttcgtgttgacggtcag
ggggctccgggtcggcgaagggcgcgggctgggcgccgccgggccccggcccggacgcga
cgctcggaagggaaggggcggacaaaaaaagaccaaatggcaaagcaaccttccgatgta
agttctgagtgtgacagagaaggtggacaattgcagcctgccgaaaggcctcctcagctc
aggcctggggcccccatctctctacagacagagcggcaaggtaatcccgaaggagaaggg
gaccgctgcccccaaggcagcccacagggcccactggccccaccggccagtcccggccct
ttcgctaccagatccccgcttttcatcttcgtgagaagatcttccctgctgtctcgatcc
tccagtgggtatttctcttttgacacagacaggagcccggcacccatgagttgtgacaaa
tcaacacaaaccccaagtcctccttgccaggccttcaaccattatctcagtgcgatggct
tccatgaggcagtctcaggctgtacctgcagatatgcgtccggagatatggattgcgcaa
gagttgcggcgtattggagacgaatttaatgcatattacccaaggagggtctttctgaat
aatcaccaagcagccgaaggtcacccgcaaatggttatcttacggctcttacgccacatc
gtccgtctggtgtggaggatgcagtga

DBGET integrated database retrieval system