KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1041Help
Entry
Dmel_CG1041       CDS       T00030                                 

Gene name
CRAT
Definition
(RefSeq) carnitine O-Acetyl-Transferase, isoform B
  KO
K00624  carnitine O-acetyltransferase [EC:2.3.1.7]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dmel_CG1041 (CRAT)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.7  carnitine O-acetyltransferase
     Dmel_CG1041 (CRAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 40787
NCBI-ProteinID: NP_001036684
FlyBase: FBgn0037440
UniProt: Q0KIA8
LinkDB All DBs
Position
3R
AA seq 657 aa AA seqDB search
MYKYQSPTSERILEKTEAEMKFRGNGKLLWNLTKNSLAQQSPNGIAKKVLPASSYSTVQK
TIPLEQPNLLKYHVLPLEETLNRFMTTVEPLLTPEEFQRQKGITSEFLKKQGRELQLLLE
ETGSKEKNWLAHRWLKAAYLTYRDPVTVFVSPGMTFPKQNFRDSRAFVDYTARVIYGLGE
FNDMVHANKIPIVKMGKNELDNSQFGKVFGTCRIPRRGTDEIVYNPDSDYVVVIYKNHFY
QLKIYSKEGKLIAAPCLAAQLENIVLKETQVGVPYGILTTDSRDNWAEAYEYLVETPGNR
DALKTIQGALFTVSLDEGTILKEGEETDELILSLIHGSGSKINSGNRWMDKTIQLVVNPN
GNVGFTYEHSPAEGQPIAMMMDYVVQKMKEDPSFGQSGSQDFAPAQKIQFSSSNKSLEKS
LNVAQENVDKLADALQMKVLKFNGFGKDFIKKQRLGPDSFVQMALQLAFYKMHSEPPAQY
ESAHLRIFDGGRTETIRSCSNESLAFSRAMQDPNVTDQERAAKLREAVVSHQTYAKLALQ
GKGVDRHLLGLKLMALEHSKPIPEFFKSPGFVKSSHFRMSTSQVATKYDAFMGYGPATDD
GYACCYNPRDNDIILAISAWRHCPITDHLKFVKTLEQSFFEMKNVLEKNPPETKSKL
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaatatcaaagcccaacgtctgagcgaatcctcgagaaaaccgaagccgagatg
aagttccgtggcaatggaaagcttttgtggaatttgaccaagaactccttggcccagcag
tctccaaatgggatcgccaagaaagtgctgcccgctagcagctacagcaccgtccagaag
accattcccttggagcagccgaatctgctgaagtaccacgtcctgccgctggaggaaacg
ctgaaccgcttcatgaccactgtggaacctctcctgacgcctgaggagtttcaacggcaa
aagggaatcacctccgagtttttaaaaaagcagggacgcgaactgcagctgctcctggaa
gaaaccggcagcaaggagaagaattggctggcccaccgctggctgaaggctgcctatttg
acctatcgagatccagtcaccgtgttcgtgagtcctggcatgacctttcccaagcaaaac
ttcagggactcacgtgctttcgtggactataccgccagggttatctatggactgggagaa
ttcaacgacatggtgcacgccaacaaaattccgatcgttaaaatgggcaagaacgagctg
gacaacagccagtttggcaaggtattcggcacatgtcggattcccagaaggggcaccgac
gagatcgtgtacaatcccgactccgattatgtggtggtgatctacaagaatcacttctac
caactgaagatatacagtaaggagggaaagctcattgctgcaccatgtctagctgctcaa
ctcgagaatatcgtcttgaaggaaacgcaagtgggagttccttatggtattctgaccacc
gactccagggacaattgggcggaggcctacgaatatctggttgagactcctggcaaccgg
gatgccctcaagaccattcagggtgctctgttcaccgtctcactcgatgagggtactatc
ctaaaggaaggcgaagagaccgacgaacttatcctatcgctgatccatggcagtggcagc
aagataaacagcggcaaccgttggatggacaagactattcagctggtggtaaaccccaat
ggaaacgtcggattcacttatgagcactcgccggctgagggccagcccattgcgatgatg
atggactacgtggtgcaaaagatgaaggaagaccctagcttcgggcaatctggctcacag
gactttgctcctgcacagaaaatacagttctcttcgagcaataaaagtctagagaaatct
ttgaacgtcgcccaggaaaacgtggataaacttgccgatgctctccaaatgaaggttctg
aaattcaacggctttggaaaggatttcataaagaaacagcgtctgggtccggacagcttt
gttcagatggcgctgcagctcgccttctacaaaatgcactcggaaccacctgcgcaatat
gagtcggcgcacttgcgcatattcgacggcggacgaaccgaaactatacgctcttgctcc
aacgaatccctggccttttcccgcgctatgcaggacccaaacgttaccgatcaggaacgc
gccgccaagcttcgtgaggcagtagtgtctcatcagacgtatgctaagctggctcttcag
ggaaagggtgtggatcgtcacctgcttggactgaagctgatggctctggagcacagcaag
ccaattcccgagttcttcaagtcgccgggctttgttaagtccagtcacttccgcatgtcc
acctcacaggtagccactaaatacgatgctttcatgggatacggcccggcgactgacgat
ggttatgcatgctgctataatcctcgggataatgacatcatattggccatatccgcttgg
cgccattgcccaataacggatcacttgaagttcgttaagaccctcgagcaatcctttttc
gaaatgaagaatgttctcgagaagaacccgcctgagactaagtcgaagttgtaa

DBGET integrated database retrieval system