KEGG   Drosophila melanogaster (fruit fly): Dmel_CG12428Help
Entry
Dmel_CG12428      CDS       T00030                                 

Gene name
CROT
Definition
(RefSeq) carnitine O-octanoyltransferase, isoform F
  KO
K05940  carnitine O-octanoyltransferase [EC:2.3.1.137]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dmel_CG12428 (CROT)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.137  carnitine O-octanoyltransferase
     Dmel_CG12428 (CROT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 43332
NCBI-ProteinID: NP_001334704
FlyBase: FBgn0039543
UniProt: Q9VB02
LinkDB All DBs
Position
3R
AA seq 618 aa AA seqDB search
MDRASLYFMSKDDKNTFDFDETLPSLPLPELRDTMERYYSCIQPFGTKEELAQARKTIDE
FQNGVGAQLHEQLKKRAAGMRNWLGTWWEDYGYHLIRMPLLPYQLMVMPSQLEMVGVPET
PEYMLKSLARHIHHSLEFWDLTRKSSIKPLSSNGGKIKYSSALYKHFFSTCRVPGEEQDH
IEKHFLTKDEGKTPSHMLISGKGRQFIFDCVHEDDTILSAPEILVALQRVRSILDYEPLG
DCVPTLSHDERSTWARNRNRLREISVANKETLLLVESACMEICWYEQSPKDYEESCQLGL
YGDLHSRWADRSSSIIAFRNGRCNWTGEHSCYDGTVSISYATFMQLSFLEVPEPDWAEAE
KGNVLEVKELHFQLDDTLKNEIKRVQKDIDDRGIDVTVTFTAFDDYGKDFMKTHRLHPDS
FVQVVMQWAYYQMHKEIAPTYETALMRQYYNGRTETLRSCTSAVAEFLRASSNKQVGDMS
LARAFRRAVDEHKHFMNEARKGHGIDRHLFGLWCAAYESKMDIPAFYDDPMYTKSGGGGN
FVLSSSTLGFTANVGFVAPMVFDGYGVFYSITSEAVFINTTAYRDSLKTSARKFNDIFKD
SFRRISVLLEQLAKESKL
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggctagtctatattttatgagcaaggatgataagaacaccttcgacttcgac
gagaccttaccttcgctcccgctgccggagcttagggacaccatggagcgctactacagc
tgcatccagccattcgggaccaaggaggagttggcccaggcccgcaagactattgatgag
ttccaaaacggagtgggagcccagctgcacgaacagctcaagaagcgggcggccggcatg
aggaactggctgggcacctggtgggaggactacggatatcacctgattcggatgccgctg
ctgccctaccagctcatggtcatgccctcgcaattggaaatggtgggcgtgccggagaca
ccggagtacatgctgaagagtctggcgcgccacattcaccactcgctggagttttgggat
ctgactagaaagtccagcatcaaaccgctctcctcgaacggcggtaaaataaagtactcc
tccgcgctgtacaagcacttcttctccacgtgccgtgtgccaggcgaggagcaggatcat
atagagaagcattttctcaccaaggatgagggcaaaacgccgagtcacatgcttatttcc
ggcaagggacgtcagttcatcttcgattgtgtgcacgaggacgacactatcctatcggct
cccgaaatcctcgtggccctgcaaagagtgcgcagcatcctcgactacgagccgttgggc
gattgtgtgcccaccctgagccatgacgaacgctccacgtgggcacgcaaccgcaaccgt
ttgagggaaatctcagttgcaaacaaggagacgctgcttctggtggagagcgcatgtatg
gagatctgctggtacgagcaatcgcccaaggactacgaggagtcctgccagctgggtctc
tacggtgatctccattcccgctgggcagaccgcagcagcagcatcatcgccttccgcaac
ggacgctgcaactggacgggtgagcacagctgctacgatggcacggtcagcataagttac
gccacattcatgcaactgagcttcctggaggtgccagagccagactgggcagaggccgaa
aaaggcaatgttttggaggtcaaggagctgcacttccagctggatgatacgctcaagaac
gagatcaagcgcgtgcagaaggatattgatgacaggggtattgacgttactgtgaccttc
actgcgttcgatgactacggcaaggactttatgaaaacccatcgactgcatccagactcc
tttgttcaggtggtcatgcagtgggcctactaccaaatgcataaagaaattgctcccaca
tatgagactgctctgatgcgacagtactacaatggacgaacagagaccctgcgatcatgc
acttccgctgtggctgaattcctgagggcgtcatccaacaagcaggttggcgatatgtca
ctggccagggcgttccgtagggcagtcgatgagcacaagcacttcatgaacgaggcgcgc
aagggacacggcatcgataggcacttgtttggcctgtggtgcgcggcgtatgaaagcaaa
atggacattcccgccttctacgacgatccgatgtacaccaagagcggcggaggaggtaac
tttgtgctctcgtccagcacgctgggcttcacggccaacgttggtttcgtggcgcccatg
gtcttcgatggctatggcgtcttttactccatcacctcggaagctgtgttcattaatacc
accgcctatcgggatagcctaaagacaagcgctcgcaagttcaacgacattttcaaggac
tcattccgccgcatcagcgttctcctggaacaattggccaaggaatccaagctatga

DBGET integrated database retrieval system