KEGG   Drosophila melanogaster (fruit fly): Dmel_CG1506
Entry
Dmel_CG1506       CDS       T00030                                 

Gene name
Ac3
Definition
(RefSeq) adenylate cyclase 3, isoform C
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00230  Purine metabolism
dme01100  Metabolic pathways
dme04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dmel_CG1506 (Ac3)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG1506 (Ac3)
Enzymes [BR:dme01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Dmel_CG1506 (Ac3)
SSDB
Motif
Pfam: AC_N
Other DBs
NCBI-GeneID: 35419
NCBI-ProteinID: NP_001014496
FlyBase: FBgn0023416
UniProt: Q95RI9
LinkDB
Position
2L
AA seq 341 aa
MEANLENGQKTIASTSKSHSQRQTTSRRRQNDSDVAGGVGITGGGVVILPQHVLNELYHN
YSIKQRRSGLKWFVFAAALFNIWTIGIPWDQSAPTRVINCCMLLAYLALTALLHIGRRSD
KPALRRFHQILLIIVPRALWLLSILHFTVYVILQPSFSPRDLLGWAILLNFLVYVTLPLQ
LIFLGLSIGCITYFICLSLPVGYSHWDSLLSNQLAANAVLIATAALIGLLYYFMGEAKQK
RAFLEAKKSLEVKMVIEEQSAEQERLLLSVLPKHVAIKMREDLGSSSSEAFKKIYMSRHE
NVRNINNCALRFLAIATTVLAVPLMSVQITPSCVCTWDSPW
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggaagcaaatttggagaacggtcagaaaacgatcgcctcgacaagcaaatcgcattcg
cagcgtcaaacaacatctcgacggcggcaaaacgacagcgatgtggccggaggcgtggga
atcaccggtgggggagtcgtcattttgccgcagcacgtgcttaacgaactctaccacaac
tactccatcaaacaacgccgcagtggattgaagtggtttgtctttgcggccgcgttgttt
aacatatggaccatcggaattccctgggatcagtcggcccctacgagagtgatcaactgt
tgtatgctgttagcttacttggcattgacagcgctccttcatattggacgccgttctgat
aaaccggcactgaggcgcttccaccaaatactcctgattattgtgccacgggcactgtgg
ctattaagcattcttcattttaccgtttatgttattctgcagcctagtttttctccaagg
gacctacttggctgggccatccttctaaatttcttggtctatgtgacgctgccattacag
ctgatttttcttggtctgtcgattggatgtatcacatatttcatttgcctcagtctccct
gttggttattctcactgggactcgctgctctcgaaccaattagcggctaatgcagttttg
atagccacggcagcgctgataggccttttgtactactttatgggtgaggccaagcagaaa
cgagcctttctcgaggccaaaaagagccttgaagttaaaatggtcatagaggaacagtcg
gccgaacaggagcgtctgctattgtctgtgctgccaaagcatgtggctattaagatgcgg
gaagatttgggatcatccagttccgaggcttttaaaaaaatttacatgagtcggcacgag
aatgtaagaaatatcaacaattgcgcattaagattcttggcgattgctactactgtatta
gcggtgcccctgatgagcgtccagatcacgccgtcctgtgtgtgcacatgggactctcca
tggtga

DBGET integrated database retrieval system