KEGG   Drosophila melanogaster (fruit fly): Dmel_CG15085
Entry
Dmel_CG15085      CDS       T00030                                 

Gene name
edl
Definition
(RefSeq) ETS-domain lacking
  KO
K20232  ETS-domain lacking
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG15085 (edl)
SSDB
Motif
Pfam: SAM_PNT
Other DBs
NCBI-GeneID: 37149
NCBI-ProteinID: NP_523786
FlyBase: FBgn0023214
UniProt: Q7K119
LinkDB
Structure
PDB: 
1SV0

Position
2R
AA seq 177 aa
MQVESSYTKYAGRVPPLDLTQVNGGQDLWGGNGGGNNASARRHLHHPYQMLDKCRGGVTL
ISASSAISSTSNSSDDNNNRLMSADDGTTSLLHPLGSDGLPLDPRDWTRADVWKWLINMA
VSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRVRLARAMALLS
NT seq 534 nt   +upstreamnt  +downstreamnt
atgcaagtggaatcgagctataccaaatatgccggacgtgtgccacctttggacctcacc
caggtgaatggtggccaagatttgtggggcggcaatggtggcggcaataacgcatccgcc
agacgccatctgcatcatccctatcaaatgctggacaagtgccgcggcggagtaaccctg
atcagtgcatcatccgccatctcatctacatccaactcctccgacgacaataacaatcga
ctgatgagcgctgatgatggcaccaccagtctgctgcatcccttgggctccgatggtctg
cctctggatccgcgcgattggacgcgagcggatgtctggaaatggctcatcaatatggcc
gtatccgagggattggaggtcaccgccgaactgccacagaaattccccatgaacggcaag
gcattgtgcctgatgagtctcgatatgtacctgtgccgagttcccgtgggcggcaagatg
ctctaccgcgacttccgggtgcgactcgcccgagcaatggccctgctatcatag

DBGET integrated database retrieval system