KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17228
Entry
Dmel_CG17228      CDS       T00030                                 

Gene name
pros
Definition
(RefSeq) prospero, isoform M
  KO
K20211  prospero homeobox 1
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG17228 (pros)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG17228 (pros)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with Prospero motifs
    Dmel_CG17228 (pros)
SSDB
Motif
Pfam: HPD
Other DBs
NCBI-GeneID: 41363
NCBI-ProteinID: NP_001247046
FlyBase: FBgn0004595
UniProt: P29617
LinkDB
Structure
PDB: 
1MIJ 1XPX

Position
3R
AA seq 1703 aa
MMSSEEYEADCFGLYSDENNVLLKANEPETTAATKQQHQPQFQQQQQQQQQQQQHHHQHQ
QPPPSSNGHTSPIPSQVNGDGSAANCGESGKTNTNTGSHSHSNSGNTNTDADKEQEREKA
KEKANEEESEDSDDDVVVVLEGCEGNASSSSSSSNSNSNASSNNHKAAATTTTTATTANH
CNRSGGSSRSHRSARSSRQISQSTAVGKTTTCAAKKPTAAQATTTTAKNSNSNSNVNVNV
NVNSNGSGNGNANSKVNRRSRQRSLSKDINNQPASSNSNSNSSNNSSNSNGGATATAAGF
MSSAAAAAAGAAGGGALFQPQSVSTANSSSSNNNNSSTPAALATHSPTSNSPVSGASSAS
SLLTAAFGNLFGGSSAKMLNELFGRQMKQAQDATSGLPQSLDNAMLAAAMETATSAELLI
GSLNSTSKLLQQQHNNNSIAPANSTPMSNGTNASISPGSAHSSSHSHQGVSPKGSRRVSA
CSDRSLEAAAADVAGGSPPRAASVSSLNGGASSGEQHQSQLQHDLVAHHMLRNILQGKKE
LMQLDQELRTAMQQQQQQLQEKEQLHSKLNNNNNNNIAATANNNNNTTMESINLIDDSEM
ADIKIKSEPQTAPQPQQSPHGSSHSSRSGSGSGSHSSMASDGSLRRKSSDSLDSHGAQDD
AQDEEDAAPTGQRSESRAPEEPQLPTKKESVDDMLDEVELLGLHSRGSDMDSLASPSHSD
MMLLDKDDVLDEDDDDDCVEQKTSGSGCLKKPGMDLKRARVENIVSGMRCSPSSGLAQAG
QLQVNGCKKRKLYQPQQHAMERYVAAAAGLNFGLNLQSMMLDQEDSESNELESPQIQQKR
VEKNALKSQLRSMQEQLAEMQQKYVQLCSRMEQESECQELDQDQDVEQEQEPDNGSSDHI
ELSPSPTLTGDGDVSPNHKEETGQERPGSSSPSPSPLKPKTSLGESSDSGANMLSQMMSK
MMSGKLHNPLVGVGHPALPQGFPPLLQHMGDMSHAAAMYQQFFFEQEARMAKEAAEQQQQ
QQQQQQQQQQQQQQEQQRRFEQEQQEQQRRKEEQQQQIQRQQQHLQQLQQQQMEQQHVAT
AAPRPQMHHPAPARLPTRMGGAAGHTALKSELSEKFQMLRANNNSSMMRMSGTDLEGLAD
VLKSEITTSLSALVDTIVTRFVHQRRLFSKQADSVTAAAEQLNKDLLLASQILDRKSPRT
KVADRPQNGPTPATQSAAAMFQAPKTPQGMNPVAAAALYNSMTGPFCLPPDQQQQQQTAQ
QQQSAQQQQQSSQQTQQQLEQNEALSLVVTPKKKRHKVTDTRITPRTVSRILAQDGVVPP
TGGPPSTPQQQQQQQQQQQQQQQQQQQQASNGGNSNATPAQSPTRSSGGAAYHPQPPPPP
PPMMPVSLPTSVAIPNPSLHESKVFSPYSPFFNPHAAAGQATAAQLHQHHQQHHPHHQSM
QLSSSPPGSLGALMDSRDSPPLPHPPSMLHPALLAAAHHGGSPDYKTCLRAVMDAQDRQS
ECNSADMQFDGMAPTISFYKQMQLKTEHQESLMAKHCESLTPLHSSTLTPMHLRKAKLMF
FWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDD
LLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYK
IISRMDDPVPEYFKSPNFLEQLE
NT seq 5112 nt   +upstreamnt  +downstreamnt
atgatgtcatcagaggagtacgaggcggactgttttggtttgtacagcgatgagaacaac
gtgctgctgaaggcaaacgagccggagacaacggccgccaccaagcaacaacatcagcca
cagtttcagcagcaacagcaacagcaacagcaacagcaacagcaccatcatcaacaccag
caaccaccgccgagcagcaacggtcacacgtcaccaataccctcacaagtcaacggcgac
ggcagcgcggcgaattgcggcgagagcggcaagactaataccaatacaggcagccacagt
cacagcaacagcggcaacaccaacacagacgcagacaaggagcaagagcgagagaaggca
aaggagaaagcgaacgaagaggagtccgaggattccgacgacgacgtcgtggttgtactc
gaaggctgcgaaggcaacgccagcagcagcagcagcagcagcaacagcaacagcaacgcc
agcagcaacaaccataaggcagcggccacgacgacgacgacggcgacgacggcgaaccat
tgtaatcgcagtggcggcagcagtcgcagtcatcgcagcgcccgcagtagtcggcaaatc
agtcagtcaacggccgtcggcaagacaacaacgtgcgcggctaaaaaaccaacagcagca
caggcgaccacgacaacagccaagaactcgaactcgaactcgaacgtgaacgtgaacgtg
aacgtgaattcaaacggtagcggaaacggaaacgcgaacagtaaagtgaatcgtcgttcg
cgtcaaagatccttgagcaaagacattaacaatcagccagcgagcagtaatagcaatagc
aacagtagtaacaacagcagcaacagcaacggcggagcaacggcaaccgctgctggcttc
atgagtagcgctgccgcggctgctgcgggtgccgctggtggaggagccctgttccaacca
caatcggtcagcacggccaatagcagtagtagtaacaataacaattcaagcacaccggct
gctcttgccacccattcgcccacgagcaactcaccagtttcgggcgccagttcggcatcg
tccttgttgacggccgcctttggcaacctgtttggtggctcctcggccaagatgctgaac
gagctgtttggccgccagatgaagcaggcccaggacgcaacgagtggcctgccccagagt
ttggacaacgccatgctggccgccgccatggagacggccaccagtgccgagctgttgatc
ggcagcctcaattccacgtccaagttgctgcagcagcagcacaataacaacagcattgct
cccgccaatagcacgcccatgagcaatggcacaaatgcatcgatctcgccgggatcggcc
cacagttccagtcactcgcatcagggagtctcgcccaaaggaagtcgcagggtgtcggcc
tgcagtgatcgctccttggaggcggcagctgctgatgttgctggtggctcgccgccacga
gcggcatcggtgagctcgctgaacggaggagccagcagtggggagcagcaccagtctcag
ttgcaacacgacctggtggcacatcacatgctgcgcaatatactgcagggcaagaaggag
ctgatgcaactggatcaggagctgcgcaccgccatgcagcagcagcaacagcagctgcag
gagaaggagcaactgcactccaagcttaacaataataataacaacaatattgctgccacc
gccaacaacaataacaacaccacaatggagagtatcaatctgatcgacgattcggaaatg
gctgacatcaagatcaagagtgagccccagacggctccgcagccacagcaatcgccgcac
ggaagcagccacagcagccgaagtgggagcggcagtgggagccacagcagcatggccagc
gatggcagcctgcgacgcaagtcctccgactccctggacagccacggggcgcaggacgat
gcgcaggacgaggaagatgctgcgcccactggccagagatccgagagcagggctccggag
gagccacagctgcccaccaaaaaagaatccgtggacgatatgcttgacgaggtggagctc
ctgggtctgcactcccgcggatccgatatggatagcctggcctcgcccagtcactcggac
atgatgctgctggacaaggacgatgtcctggacgaggacgacgacgatgattgcgtggag
cagaaaacatccggcagcggatgtctcaagaaacccggcatggacttgaagcgcgctcgc
gtcgagaacatcgtgtcgggaatgcgatgcagtccatcctccggattagcgcaggcagga
caactgcaggtaaatggttgtaagaagcgcaagctctaccagccccagcaacacgccatg
gagcgttatgtggccgccgcagctggtctgaatttcggcctcaatctgcagagcatgatg
ctcgaccaggaggacagtgagtccaatgagctggagtccccgcaaatccaacagaagcgt
gtggagaaaaatgcgctcaagtcccagctgcgatccatgcaggagcagctcgcggagatg
cagcagaaatatgtgcagctgtgctcgcgcatggagcaggaatccgagtgccaggaactt
gaccaggaccaggatgtggaacaagaacaagagccggacaatggcagcagtgatcatatc
gagctgtcgccctcgcccactttgaccggagatggtgacgttagtcccaaccacaaggag
gaaactgggcaggaacgacctggttccagctcaccctcaccatcgcccctaaaacccaag
acatcgctgggcgagagcagcgactcaggcgctaacatgctatcccagatgatgagcaag
atgatgtccggcaagctgcacaatccactggtgggtgtgggtcatcccgccctgcctcaa
ggatttcctccactgctccagcacatgggcgacatgtcgcacgcagccgccatgtaccag
cagttcttcttcgagcaggaggcgcgcatggccaaggaagccgccgagcagcagcagcaa
cagcagcaacagcaacaacagcagcagcagcaacagcagcaggagcaacagcgccgcttc
gagcaggagcaacaagagcagcagcgacgcaaggaggagcagcaacagcagatccagcgc
cagcagcagcatctgcaacagctgcagcaacagcaaatggagcagcaacatgtggccact
gccgcccccaggccgcagatgcaccacccagcgcccgcccgcctgcccacacgaatgggc
ggtgctgctggccacacggccctcaagtccgaactgtcggaaaagttccaaatgctgcgc
gccaacaacaatagctcaatgatgcgcatgtcgggcacggacctggagggactggccgat
gtgctcaagtccgagatcaccacctcgctgtccgctctggtggacaccattgtgacccgc
ttcgtccaccaacggcggctgttcagcaagcaagcggactccgtgaccgcggctgccgag
cagctgaacaaggacctgctgctggcttcgcagatcctcgaccggaagtcaccgcgcacc
aaggtggcggacaggccccagaacggacccacgcccgcaacacaatcagcggctgccatg
ttccaggcgcccaaaacgccacagggcatgaatccggtggccgccgccgcgctctacaac
tcgatgaccggacccttctgcctgccgcccgatcagcagcagcagcaacagaccgcccag
cagcaacagtccgcccagcagcagcagcagagctcgcagcagacacaacagcagctggag
cagaacgaggccctcagcctggtggtgacaccaaagaagaagcgccataaggtgaccgat
acgcgcatcacgccgcgcaccgtcagccgcattcttgcccaggatggcgttgtgccgccc
accggaggcccaccgtcaaccccccagcagcagcaacagcagcagcaacagcaacagcag
cagcaacaacagcagcagcaacaggcgtcgaacggcggcaacagcaatgccacgcccgcc
cagagtccgacgaggagcagtggaggagccgcataccatccgcaaccaccgccaccacca
ccacccatgatgcccgtgtccttgcccacctccgtggccatacctaatccctcgctgcac
gagtccaaggtcttttcaccgtactcgccgttcttcaatccgcacgcagccgctggccag
gcaacggcggcccagctccatcagcaccaccagcagcaccacccgcaccaccagtccatg
cagctgtcctccagtccgccgggcagcttgggcgctctgatggactcgcgcgactcgccg
ccgctgccccacccgccgtcgatgctccatcccgccttgctggccgccgcccatcacggc
ggatcgccggactacaagacctgcctgcgggccgtcatggacgcccaggatcgccagtcc
gagtgcaactcggccgacatgcagtttgacggcatggctcctactatatccttttacaaa
caaatgcaacttaaaacagaacaccaggagtcgctgatggccaaacattgcgaatccttg
actcctttgcactcttctacattgacaccgatgcacctgcgcaaggccaagctgatgttc
ttctgggtgcgctatcccagctccgcggtgctcaagatgtacttcccggacatcaagttc
aacaagaacaacacagcacaattggtgaaatggttctcgaacttccgagaattctactac
atacaaatggagaaatatgcacgacaagctgtcaccgaaggcatcaagacacccgatgat
ctgttgattgctggagatagtgaattgtatcgcgtgctcaatttgcactacaatcgcaat
aaccacattgaggtaccccagaatttccgcttcgtggtcgaatcgactctgcgggagttc
ttccgtgcaatacagggtggcaaagacaccgagcagtcgtggaagaagtccatatacaag
atcatctcgcgcatggacgatcccgtgcccgagtacttcaagtcgcccaattttttagag
cagctggaataa

DBGET integrated database retrieval system