KEGG   Drosophila melanogaster (fruit fly): Dmel_CG17302
Entry
Dmel_CG17302      CDS       T00030                                 
Symbol
Prosbeta4R2
Name
(RefSeq) proteasome beta4 subunit-related 2, isoform B
  KO
K02734  20S proteasome subunit beta 4 [EC:3.4.25.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03050  Proteasome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    Dmel_CG17302 (Prosbeta4R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG17302 (Prosbeta4R2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:dme03051]
    Dmel_CG17302 (Prosbeta4R2)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     Dmel_CG17302 (Prosbeta4R2)
Peptidases and inhibitors [BR:dme01002]
 Threonine peptidases
  Family T1: proteasome family
   Dmel_CG17302 (Prosbeta4R2)
Proteasome [BR:dme03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    Dmel_CG17302 (Prosbeta4R2)
SSDB
Motif
Pfam: Proteasome TOPRIM_C DUF4174 DUF6337
Other DBs
NCBI-GeneID: 33451
NCBI-ProteinID: NP_001259950
FlyBase: FBgn0031443
UniProt: Q9VQE5 M9PE80
LinkDB
Position
2L
AA seq 210 aa
MAMETILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTD
FISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEGPDLHYI
DSYGAAQSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNF
EVYVVDSKGMRKMEAINPGSLNKESISLSW
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcgatggaaactattttggggatcaagggaccagactttgtgatgctagcatcagat
acaatgcaggccaaatcgctggtcttcatgaaagatgaccaatcaaaaatccaccgacta
tcagacttcaatatgatggccacggtgggtgatggtggcgataccattcagttcaccgac
ttcatatccaaaaatttgcatctgtacaagatttcccacggataccatctaagtgcgaag
tcagctgcccattttaccaggaaaacactggcggattatataaggaccaacaccagatac
caggtggcaatgctcctggcaggatacgatgcggttgagggacctgacctccactacatc
gactcctatggcgctgctcagtcaatcaatcatgcaggtcatggttggggcagcatgttc
tgtggcagcattctgcagagatattggaactcgaagctcagccaagaggatgcctactcg
ctgatgaagaagtgcgtcctggagatccaaaggcgactgatcatcaaccagcggaacttt
gaggtgtatgtagtggacagcaagggaatgcgcaagatggaggccatcaatccaggatcc
ctaaacaaggagtcgataagcctgagttggtaa

DBGET integrated database retrieval system