KEGG   Drosophila melanogaster (fruit fly): Dmel_CG18492
Entry
Dmel_CG18492      CDS       T00030                                 

Gene name
Tak1
Definition
(RefSeq) TGF-beta activated kinase 1, isoform A
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04140  Autophagy - animal
dme04214  Apoptosis - fly
dme04310  Wnt signaling pathway
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG18492 (Tak1)
   04310 Wnt signaling pathway
    Dmel_CG18492 (Tak1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG18492 (Tak1)
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG18492 (Tak1)
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG18492 (Tak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG18492 (Tak1)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     Dmel_CG18492 (Tak1)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: TKL group
  MLK family
   Dmel_CG18492 (Tak1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase
Other DBs
NCBI-GeneID: 39659
NCBI-ProteinID: NP_524080
FlyBase: FBgn0026323
UniProt: Q9V3Q6
LinkDB
Position
X
AA seq 678 aa
MATASLDALQAAYVDFSEITLREKVGHGSYGVVCKAVWRDKLVAVKEFFASAEQKDIEKE
VKQLSRVKHPNIIALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQ
CAEGLAYLHAMTPKPLIHRDVKPLNLLLTNKGRNLKICDFGTVADKSTMMTNNRGSAAWM
APEVFEGSKYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPK
RIEDLMTACWKTVPEDRPSMQYIVGVMHEIVKDYTGADKALEYTFVNQQIVTKESDGTVA
AQPDSLSSQEGELSPSSTQLTPTTAANANVNAIAISKTTTSSMTENTSSTSSDITPTNSG
QLDNNPLFYMVTNRWDAIPEEESNESRNDSFNLTSSAEATQRLETIRNGMILMACKPMEQ
LTLDVEANGFDLSPSESSSSSTNAKSDGRERLTVTDTKPVMMTTDLSNNNGGIHAHSNGL
LSHANGWQARDEELQEQEHEQEIVNSLDVDVDPDEDENDGTEQSLAEILDPELQPEPPIP
NDAESQLIYRDHRHMAKEYLSVDTNLYYAQDFKDKLIVQMDRTEREQKQELLRKMKDKEG
LQSLYNNLQQQYASRQLAAGHHPQPHPHPHPNQLQHPHSHPPMHFLQDEGCGLLPGSVCG
GSESVEEGWVVIPPHHNA
NT seq 2037 nt   +upstreamnt  +downstreamnt
atggccacagcatcgctggacgcactgcaggcagcctatgtggacttcagtgagataaca
ctaagagagaaagtcggccatgggtcctacggagtggtctgcaaggccgtttggcgcgac
aagctggttgccgtcaaggagttcttcgccagcgccgagcagaaggacatcgagaaggag
gtgaagcagttgtcgcgcgtgaagcacccgaacatcatcgctctgcacgggatatcctcg
taccagcaggccacctacctgataatggagttcgccgaaggtggatcgctgcacaacttc
cttcacggcaaggtgaagccggcatattctctggcccacgccatgagctgggcgcgccaa
tgtgcagagggtctggcatatttgcatgccatgacgccaaaaccactaatacatcgcgac
gtgaagccgctgaacctgctcttgaccaacaagggacgcaatctgaagatatgcgacttc
ggcacggtggcggacaagtcgaccatgatgaccaacaatcgcggcagtgccgcttggatg
gcgcccgaggtcttcgaaggctccaagtatacggagaagtgtgacatttttagctgggcc
attgttctatgggaggttctgtccaggaagcagccctttaaaggcatcgacaatgcctac
accatccagtggaagatctacaagggtgaacgcccgccgctgctgaccacttgccccaag
cgcatcgaggacctgatgaccgcctgctggaaaacggtgcccgaggatcgcccgtcgatg
cagtacatagtgggcgttatgcacgagatcgtcaaggactatacgggggcggacaaggcc
ctggaatacacgtttgttaatcaacagattgtcaccaaagagagcgacggcacggtggcc
gctcaaccggatagcctcagttcgcaggagggggaactgagcccctcgtccacacagtta
acaccgacaacggcggccaacgccaatgtgaacgcgatagcaatatcaaaaacaacgact
agctcaatgaccgaaaatacctcatcaacatcatcggacatcacgccgacgaactcgggc
caactggacaataatccgctattctatatggtcaccaatcgctgggacgcgattcccgag
gaggagagcaacgagagccggaacgatagcttcaacctcacctcgtcggctgaggccact
cagcgcctcgaaacgatccggaacggcatgatcctgatggcctgcaagcccatggagcag
ctcaccctcgacgtggaggcgaatggctttgatctgagtcccagcgaaagcagcagcagc
agcacgaacgcaaagagcgatggccgcgaacgactcacggtgacggacaccaagccggtg
atgatgaccacggatctgtccaacaacaacggcggcatccacgcccactcgaacggactg
ctgagccatgcgaatggttggcaagcaagagatgaggagctgcaggagcaagagcatgag
caggagattgtcaactcgttggacgtcgacgtggatcccgacgaggatgagaacgacggc
accgaacagtcactggccgagattcttgatccggagctccagccagagccgccgataccc
aacgatgccgaatcgcagctcatctaccgggaccaccgacacatggccaaggagtacctg
agcgtcgacacgaacctctactacgcgcaggacttcaaggacaagctcatcgtgcagatg
gaccgaaccgagcgcgaacagaagcaggagcttctgcgcaagatgaaggacaaggagggt
cttcagagtctttacaacaatctgcagcagcagtacgcttcacgccaacttgcggccggc
catcatccgcaacctcatcctcatccgcatccaaatcagcttcagcatccacactcacat
ccgcctatgcatttcctgcaggatgagggctgtggactgctgcccggatcggtgtgcgga
ggctctgagtccgtggaagaaggctgggtggtcatcccaccgcatcacaatgcgtag

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31421
Entry
Dmel_CG31421      CDS       T00030                                 

Gene name
Takl1
Definition
(RefSeq) Tak1-like 1
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04140  Autophagy - animal
dme04214  Apoptosis - fly
dme04310  Wnt signaling pathway
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG31421 (Takl1)
   04310 Wnt signaling pathway
    Dmel_CG31421 (Takl1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG31421 (Takl1)
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG31421 (Takl1)
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG31421 (Takl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG31421 (Takl1)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     Dmel_CG31421 (Takl1)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: TKL group
  MLK family
   Dmel_CG31421 (Takl1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH FTA2 Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 318725
NCBI-ProteinID: NP_732554
FlyBase: FBgn0046689
UniProt: P83104
LinkDB
Position
3R
AA seq 393 aa
MVKQVDFAEVKLSEKFLGAGSGGAVRKATFQNQEIAVKIFDFLEETIKKNAEREITHLSE
IDHENVIRVIGRASNGKKDYLLMEYLEEGSLHNYLYGDDKWEYTVEQAVRWALQCAKALA
YLHSLDRPIVHRDIKPQNMLLYNQHEDLKICDFGLATDMSNNKTDMQGTLRYMAPEAIKH
LKYTAKCDVYSFGIMLWELMTRQLPYSHLENPNSQYAIMKAISSGEKLPMEAVRSDCPEG
IKQLMECCMDINPEKRPSMKEIEKFLGEQYESGTDEDFIKPLDEDTVAVVTYHVDSSGSR
IMRVDFWRHQLPSIRMTFPIVKREAERLGKTVVREMAKAAADGDREVRRAEKDTERETSR
AAHNGERETRRAGQDVGRETVRAVKKIGKKLRF
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggtcaagcaagtggattttgcggaggtgaagctcagtgagaaatttctcggagctgga
tctggtggagcggtgcgcaaagccacctttcaaaatcaggagattgcagtaaagatattt
gatttccttgaggaaacaatcaaaaagaatgcagagagggaaatcacacatttgtcggag
atcgaccacgaaaacgttatcagggtgatcgggagggccagcaatggaaagaaggactac
ttgttgatggagtacctggaggaggggtccctccacaactacctctatggcgatgacaag
tgggagtacaccgtggagcaagcggttcgctgggcactccaatgcgccaaggccttagca
tacttgcattcgttggatcgaccgattgttcaccgcgatattaagccgcaaaacatgctt
ttatataatcagcatgaagacttaaagatttgtgactttggcctggcgacggatatgtcc
aataataagaccgatatgcaaggaacattgaggtatatggctcccgaggccattaagcac
ttaaagtatacggctaagtgtgatgtgtacagctttggaataatgctctgggagctgatg
acacgtcaattgccatatagtcacttggaaaaccccaacagccagtacgccattatgaaa
gctatcagttcaggcgaaaaacttccaatggaagcagtaagatccgattgcccagagggt
atcaagcaattaatggaatgttgcatggatataaatcccgaaaagcgcccctctatgaag
gagatcgaaaagttccttggcgaacagtatgaatccggcactgacgaggactttatcaag
cctttggatgaggataccgtggctgtggtgacctaccatgtggattcgtccggcagcagg
ataatgcgtgttgatttctggcgacatcagttgccatcgatccgcatgacttttccgata
gtgaaacgggaagccgaaagattgggaaagaccgttgtcagagaaatggccaaggcggcg
gcggatggagatcgggaagttcggcgggctgagaaggacacggagcgtgaaacctcgagg
gctgcccacaatggagagcgggaaacgcggagagcgggtcaggatgtgggtcgtgaaact
gtacgggcggtcaagaaaataggaaagaaactgcgcttctaa

KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4803
Entry
Dmel_CG4803       CDS       T00030                                 

Gene name
Takl2
Definition
(RefSeq) Tak1-like 2
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04140  Autophagy - animal
dme04214  Apoptosis - fly
dme04310  Wnt signaling pathway
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG4803 (Takl2)
   04310 Wnt signaling pathway
    Dmel_CG4803 (Takl2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG4803 (Takl2)
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG4803 (Takl2)
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG4803 (Takl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG4803 (Takl2)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     Dmel_CG4803 (Takl2)
Protein kinases [BR:dme01001]
 Serine/threonine kinases: TKL group
  MLK family
   Dmel_CG4803 (Takl2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH
Other DBs
NCBI-GeneID: 42692
NCBI-ProteinID: NP_651090
FlyBase: FBgn0039015
UniProt: Q9VCV0
LinkDB
Position
3R
AA seq 281 aa
MSAPVEGVPYEEIQTKELIGTGFYGSVYRAVWRNREIALKRIREGCEDKKIEREIYQLTK
ASHVNIVELYGTSRHEGCALLLMEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIA
YLHGMQPKAVIHRDIKPLNTLLCEKGLKLKICDFGTVVDLSQSISCNAGTCRYKAPEVLQ
GNKPDEKCDVYSWAITFWEILSRKEPFEQYNTLFELYMAINEGERPDLSCIMSGCPADIV
ALLYASWDPDISKRFSMELISQSMGRILSEAGSIPPLDFYS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtccgctcctgtagagggtgttccctatgaggagatccagacaaaagagcttataggc
accggattctatggcagcgtatacagggcggtctggagaaatcgtgagatcgcgctgaag
agaattcgcgagggatgtgaggataaaaagattgaaagagagatctaccagctgacaaag
gccagccatgtcaacatagttgagctctacggcacatcgaggcacgagggatgcgccctg
ctgttgatggaattcgtagacggtggatctctgtccagttttctgcacgcgaaaagcaag
ccaagttattcgcatgcccacgccttcaactgggcgcatcagatcgctcagggcatagcc
tatctgcatggcatgcagccgaaagcagtaattcatcgcgatataaagccactcaataca
ctgctatgcgagaagggactcaaactgaagatttgcgatttcggaactgttgtggaccta
tcccaatcgatatcgtgcaatgcgggcacctgcagatacaaagcgcccgaggttctacaa
ggaaataaacccgatgaaaagtgcgatgtgtatagttgggctattaccttttgggaaata
ttgtcgcgcaaggagccatttgagcaatataatacgctttttgaactgtacatggctatt
aatgaaggcgagagaccggatttaagttgcattatgtctggctgccccgcggatatagtt
gctcttttgtacgcttcttgggatccggatatcagcaaaagattttctatggaactgatt
tcccaaagcatgggtagaatcctaagtgaggcgggatccattccaccactggatttttac
tcataa

DBGET integrated database retrieval system