KEGG   Drosophila melanogaster (fruit fly): Dmel_CG18729
Entry
Dmel_CG18729      CDS       T00030                                 

Gene name
Zwilch
Definition
(RefSeq) zwilch
  KO
K11579  protein zwilch
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG18729 (Zwilch)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     RZZ complex
      Dmel_CG18729 (Zwilch)
SSDB
Motif
Pfam: Zwilch
Other DBs
NCBI-GeneID: 59247
NCBI-ProteinID: NP_733421
FlyBase: FBgn0061476
UniProt: Q9VA00
LinkDB
Position
3R
AA seq 641 aa
MSASANLANVYAELMRRCGESYTITYGAPPTYLVSMVGAAEAGKKIVLVFKEDRNGAVAR
LRTTPTRAAPKKEGSADLDLTGSPLKDDCLVDAIADLSIDLQLDHSNPWKLEEEYQRGIP
VDKARSIVCSEFLQLAEGLGSVWFLCDGSDLGQTQLLQYEFNPTHFSRGILSYQGVRPAY
LVTSQALVRHHGKTPDETLIENSYQVNPHMRLRCSWTSSAALPLLVNLNDCDVALNHTFR
VGDCGPLTQDFMNQLRILVYIREDIVSYHTDVKQGVSRDPTYRCGSGIDMDELRESINQT
MTDVSGLIGRYSISNAEFDIEDVVQRAKVRQLTDLTDKLWELLKCCHSYKDLKIAFSMLF
QCAARCNIVNTPTNKNRLAKIITELANRRLAMPCLSGAEPLELLLEIGLEKLYKDYEFIY
TESKMCSTNLLKDDSSGASMDDGSPQNLPQLRKSLHNAVRGDPTPGAGMRKTLLHHHGAV
NSRSTKYAGSDDDAGFKNSHFDEHESTERISKLFQIHCTLEHLLMMHIHLNLANVYNDVC
SELLKKPPKLVESIDDQLSDVMDIRLSAHYVRDHLDGKDPYSRHITMRSHNKFRELKTTF
YFNSENICPPNLAQCFQCDDKEMVKERTYHSWIYHKIRSLK
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgtcggcttctgcgaacttggcaaacgtttacgcggagctaatgcggcggtgtggcgag
tcatacacgatcacctatggagcgccacccacctacttggtgagcatggtgggggctgcg
gaagctggcaagaagattgtgctggtctttaaggaggatcgcaatggagcagtggcgaga
ctccggaccacgcccaccagggcagccccaaaaaaagagggctctgcggacttggatctg
acgggaagtcctttgaaggacgactgcctggtggacgccatagccgacttgtccatcgac
ctgcagctggatcactcgaatccctggaagctggaggaggaatatcaacgcggaataccc
gtggacaaggctaggtccatcgtgtgctccgagttcctgcagctggccgagggactcgga
tccgtgtggtttttgtgcgacggcagtgatctcgggcagactcagttgctccagtacgag
ttcaaccctacgcacttctccaggggaatacttagctaccagggtgtgcgccctgcttac
ttagtaacctcgcaagccctggtgcgccatcatggcaagacaccggatgaaactctcatt
gaaaatagctaccaggtcaatccccacatgagactacgctgctcctggacctctagtgct
gcacttccgctcctggtgaacctgaacgactgcgatgtggctttgaatcacacttttcgc
gtgggcgactgcggtcctttgacgcaggactttatgaatcagctgcgcattctggtctac
atacgcgaggacatcgtctcctaccacacggatgtcaagcagggcgtctctcgggatccc
acctatcgttgtggcagtggcattgacatggacgagctgcgcgagtccattaatcagaca
atgacagatgtctctggccttataggtcggtatagcatcagcaatgcggagtttgacatc
gaagatgtggtgcagagggccaaggttcgccagctcacggatctaaccgataagctttgg
gagctgctcaagtgctgccactcctacaaggatctcaaaattgcctttagtatgctcttc
caatgtgctgcacggtgtaacatagtaaacacgcctactaacaaaaatcgacttgccaag
attatcaccgagttggccaaccgtcgtctggccatgccttgtttaagtggggccgagcct
ctggaactgcttttggaaattggcctggagaagttgtacaaggactacgagtttatctac
accgagagcaagatgtgcagcaccaatctgttgaaggatgactccagcggagcgtcgatg
gacgatggttctccccagaatctgccccagcttcgaaaatccctgcacaatgcggtcagg
ggtgatccgacccctggagctggaatgcgaaagacgctgctgcatcatcacggcgctgtc
aattcgcggagtacaaaatatgccggtagcgacgatgatgctgggttcaaaaacagccat
ttcgacgagcacgagagtacggagagaatctcaaagttgtttcagattcactgcacctta
gagcatctcctgatgatgcacatccacttaaatctggcaaatgtttacaacgatgtctgt
tctgaattgctgaagaaaccgcctaaattagtagaatccatcgatgatcagctaagtgat
gttatggacattcgcctgtctgcccactatgtgagggatcacttggatggcaaggatccc
tactcccggcacattaccatgcgttcgcacaacaagttccgcgaactaaagaccaccttc
tatttcaattcggaaaacatttgtccgccgaacttggctcagtgtttccagtgtgatgac
aaggagatggtcaaggagcgcacatatcattcctggatatatcacaagattcgctcactt
aagtaa

DBGET integrated database retrieval system