KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3166
Entry
Dmel_CG3166       CDS       T00030                                 

Gene name
aop
Definition
(RefSeq) anterior open, isoform C
  KO
K03211  ETS translocation variant 6/7
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG3166 (aop)
 09150 Organismal Systems
  09158 Development and regeneration
   04320 Dorso-ventral axis formation
    Dmel_CG3166 (aop)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG3166 (aop)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    Dmel_CG3166 (aop)
SSDB
Motif
Pfam: Ets SAM_PNT
Other DBs
NCBI-GeneID: 33392
NCBI-ProteinID: NP_001259908
FlyBase: FBgn0000097
UniProt: Q01842 M9PC88
LinkDB
Structure
PDB: 
1SV0 1SV4

Position
2L
AA seq 732 aa
MSKMKMLPVQLSLNSLNPGIWSDVLWRCPPAPSSQLAELKTQLPPSLPSDPRLWSREDVL
VFLRFCVREFDLPKLDFDLFQMNGKALCLLTRADFGHRCPGAGDVLHNVLQMLIIESHMM
QWHLPNSPVTPTSRYPLSPHSHPPTPTWPPLNAPPENSPFHSSAHSLAGHHFMAPNSVTL
SPPPSVDSQASSPPQAPYQNGGATGAAPGSAGGSAPAAGGATNTSNPTSSSASSTGSNGS
QPNIMPMKGISSASSNHSDSEEEYSETSGGVSKMPPAPLSYSTASPPGTPILKDIKPNWT
QQLTNSFVNSWSQQQQQQQQQQAAAVAAVAAQAQQHQLQQQQQQQQLPQKLTLDNTAGPV
VTPAGGSISAPTTPSYMYKAKREFFPENSEPNTNGRLLWDFLQQLLNDRNQKYSDLIAWK
CRDTGVFKIVDPAGLAKLWGIQKNHLSMNYDKMSRALRYYYRVNILRKVQGERHCYQFLR
NPTELKNIKNISLLRQSTPANGNGGSPSMPQGSSQAPGSPAGQNWNPQQQSQQQQQSPQR
PASRNGPMSLPAVAAVAAAAAAAYGPPPTSPLFMHAINGAFHYLSAAAAGPPPNSPALNT
PSAVGGPDKFQFHPLKLENGSGSGSESAGEDLKPTDLSVSSKSTATSNEDCYPLIRNADG
LTTIKLIRYNEHQVAASPAGQSPKHDDQQAGASNASSSPRPMDQASEQAQPVPMESDCNG
GESEDSFRHMQQ
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgtccaaaatgaaaatgctcccagtacagttatcattgaactcgctgaatcccggcatc
tggagcgatgtgctgtggcgctgtcccccagcgccgtccagccagctggcggagcttaag
acgcaactgcccccatccctgccttccgatccgcgcctctggagccgcgaggatgtgctt
gtcttcctgcggttctgcgtccgcgaattcgatctccccaaacttgactttgatctcttc
caaatgaacggcaaggcgctgtgcttgctgacgcgggcggactttggtcaccggtgtcct
ggggcaggagatgtgctccacaatgtgctgcagatgttgatcatagagtcccacatgatg
cagtggcacctgcctaatagtccagtgacgcccaccagtcgttatcccctgtcgccgcac
agccatccgccgacgcccacgtggccaccgctgaatgctcctcccgagaacagtcccttc
cacagttctgctcacagtctggcaggccaccattttatggcgcctaactcggttacgctg
agtcctccgccctcggtggattcccaggcgagtagtcctccccaggcaccttaccaaaat
ggaggagccactggagcagcaccaggatcagcaggaggatcagcaccagctgcaggagga
gccacaaacaccagcaatcccacgtcgtcgagtgccagcagcaccggcagcaatggctcc
cagccgaacattatgcccatgaagggtattagcagtgccagcagtaatcactctgattcc
gaggaggagtactctgagaccagtggtggagtgagcaagatgccaccagcaccactgtcc
tacagcacggccagtccgccaggaacacccatactgaaagatattaagccgaattggacg
caacagctcacgaatagttttgtgaactcatggtcccagcagcagcaacagcagcagcag
caacaagctgctgcagtggccgcagtagctgctcaggcgcagcagcaccagttgcagcag
cagcagcagcaacaacaattgccccagaagctgaccctggataatactgctggtccagtt
gtgacccctgctggaggatccatctccgcacctaccacgcccagttatatgtacaaagca
aagagggagttcttccccgagaattctgagcccaatacaaatggccgcctgttgtgggac
ttcttgcaacagctgctgaacgatcgcaaccagaagtacagcgatctgatagcctggaaa
tgccgcgatacgggagtcttcaagatcgtcgaccccgccggactggcaaagttgtggggc
atccagaagaaccatctgtccatgaattacgacaagatgtcgcgtgccctgcgttattac
tacagggtaaacatactgcgcaaagtgcagggcgagcgacattgctatcagtttctgcgc
aatcccacggaactgaagaacatcaagaatatatcgcttttgcgtcaatcgacaccggcg
aatggcaatggcggcagtccatcaatgccacagggtagcagtcaggcacctggaagtccg
gctggccaaaactggaatccccagcagcagtcccagcagcaacaacaatcaccacagcgg
cccgcctcgcgtaatggtcccatgagcctgcccgccgttgcagcggtagcagcagcggct
gctgcggcctatggtccaccacccacatcgccgctcttcatgcacgccatcaatggagcc
ttccactacctttcggcggcggcagctggtccgccacccaattcccctgccctaaacaca
ccatccgctgttggaggacccgacaagttccagttccatcccctcaagctggagaatggc
tcgggatcgggttcggaaagcgctggcgaggatctgaagcccacggacctcagtgtgagc
agcaagagcactgctaccagcaacgaggactgttatccactcattcgcaacgctgacggc
ctgacgaccatcaagttaatacgatacaacgaacaccaggtagccgcttcgccagcgggg
cagtcccctaagcacgatgaccagcaggcaggcgcctccaatgccagcagctcacccagg
cccatggatcaggccagtgaacaggcacagccagtgccgatggaaagcgattgcaatggc
ggcgagtcggaggactccttccgacacatgcagcagtag

DBGET integrated database retrieval system