KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3961
Entry
Dmel_CG3961       CDS       T00030                                 

Symbol
CG3961
Name
(RefSeq) uncharacterized protein, isoform E
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00061  Fatty acid biosynthesis
dme00071  Fatty acid degradation
dme01100  Metabolic pathways
dme01212  Fatty acid metabolism
dme04146  Peroxisome
Module
dme_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Dmel_CG3961 (CG3961)
   00071 Fatty acid degradation
    Dmel_CG3961 (CG3961)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dmel_CG3961 (CG3961)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:dme01004]
    Dmel_CG3961 (CG3961)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG3961 (CG3961)
Enzymes [BR:dme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Dmel_CG3961 (CG3961)
Lipid biosynthesis proteins [BR:dme01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Dmel_CG3961 (CG3961)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Dmel_CG3961 (CG3961)
  Exosomal proteins of breast cancer cells
   Dmel_CG3961 (CG3961)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 40056
NCBI-ProteinID: NP_001262024
FlyBase: FBgn0036821
UniProt: M9PCX4
LinkDB
Position
3L:complement(18878250..18890483)
AA seq 666 aa
MSCCGQITSIRVPIELSNQSDVLKIIYDHRQDIHHRGPEQIHVSKFYKESKNGKFVSYIT
ENVRTLYQTFREGAYASNNGPCLGWRETLTSPYQWINYDEALLRAKNFGAGMLALGARPK
QLIGIYSQNRPEWILYEQGCYSFSLVVVPLYDTLGPDACAFIIRQTDMQVVIVEDDGKAA
MLLEKAPRSLKIIVAIKPIRQTTLERARSRGIQIFSFIDVEKLGAKGNHPEVPPTAEDLC
TVCYTSGTTGNPKGVMLTHGNVVAGVCSVILQMGDHRIRAGDVMVSFLPLAHMFERCCEN
GMYYVGGCVGFYSGDIKELTNDLKMLKPTVMPAVPRLLNRVYDKIQNDISASGLKRGLFN
MAMRAKEKEIARGVLRRNGCWDKLVFKKVHQAFGGNLRLMVVGSAPLAGNVLTFMRCALG
CLVLEGYGQTECTGAITLTVQGDHVPNHVGPPVSCNAVKLVDVPEMEYFANQNTGEVCVR
GSNVFHGYYKDPEKTAEAIDSEGWHHTGDVGMWLPNGTLRIIDRRKHIFKLSQGEYIVPE
KIENIYTLSQYVNQVYVYGESLKSCIIAVVVPDTDVLKQWATENNVRGTLSVLCNNKNVK
ELIMNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQNGLLTPTFKAKRPQLKSYFKPQLED
MYKHLD
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgtcctgttgcggccaaatcaccagtatacgagtgcccatcgagctaagcaatcagagc
gatgtgctcaagatcatatacgatcatcgtcaagatatccaccataggggtccagaacaa
atacacgtctccaagttctacaaggagtcgaagaacggcaagttcgtgtcctacatcaca
gagaatgtccgcaccctgtaccagacgttccgcgagggcgcctacgcctccaacaatgga
ccatgtcttggctggcgcgagaccctgacctccccctaccagtggatcaactacgacgag
gccctgctgcgtgccaagaactttggagccggaatgctggcgctaggagccaggccaaag
cagttgattgggatctactcgcagaaccgcccggaatggatcctgtacgagcagggctgc
tactccttctccttggtggtggtgccgctgtacgacaccctgggccccgatgcctgcgcc
ttcatcatacgccagacggatatgcaggtggtgattgtggaggacgatggcaaggcggcc
atgctgttggagaaggcgccgcgcagtctgaagatcatagtggctatcaagcccatccgg
cagacgaccctggagcgggcacgcagccgaggcatacagatattctcatttatcgatgtg
gagaaactaggtgccaaaggcaaccatccggaggtgccgccgacggcggaggatctttgc
acggtgtgctacacgtccgggacgacgggcaatccgaagggcgtgatgctcacccacggc
aacgtggtggccggcgtctgttctgtgatcctgcagatgggcgaccatcgcatccgggcg
ggcgatgtgatggtgtcattcctgcccctggcccacatgttcgagcgttgctgcgagaat
ggaatgtactatgtgggcggctgtgtgggcttctattccggcgacatcaaggaattaacc
aatgacctcaagatgctgaaaccaaccgtaatgccggcagtgcctcgtcttttgaaccgc
gtctacgacaagattcagaatgatatctcagcgtctggactgaagaggggtctcttcaat
atggctatgcgagcgaaggagaaggagatcgccaggggtgtcctgcggaggaacggctgc
tgggacaagttggtcttcaagaaggtgcatcaggcctttggcggaaatcttcgtttaatg
gtcgtgggctccgccccattggccggaaatgtcctgaccttcatgcgctgtgctctgggc
tgcctggttctcgagggatatggccaaacggagtgcacgggggccattacccttaccgtt
cagggagatcatgtgcccaaccatgtgggaccacccgtgtcctgcaatgctgtgaaactg
gtggatgtgccggagatggagtactttgccaatcaaaatactggcgaggtgtgtgtgcgc
ggatcgaatgtgttccatggttactataaggatcccgaaaagacggcggaggccatcgat
tcggagggctggcatcatacgggcgatgtgggcatgtggctgccaaatggaacactacgg
atcatcgatcgccgcaagcacatcttcaagcttagccagggcgagtacatagtgcccgag
aagatcgagaatatctacacgctcagtcaatacgtaaatcaagtttatgtctatggagag
agcttaaagagctgcattatcgctgttgttgtacctgataccgatgtactgaagcaatgg
gccacggagaacaatgtacgcggcacactctccgtcctgtgcaataataagaatgtcaag
gaactgatcatgaacgacatgctcaactggggcaagcagagtggactcaagtcattcgaa
caggttaaagatatctatctgcatccggatcccttctcggtgcaaaacggactgctgacg
cccacattcaaagccaagagaccgcagcttaagagctattttaagccccagctggaggat
atgtataaacacctggattaa

DBGET integrated database retrieval system