KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8049
Entry
Dmel_CG8049       CDS       T00030                                 

Gene name
Btk29A
Definition
(RefSeq) Btk family kinase at 29A, isoform E
  KO
K07364  tyrosine-protein kinase Tec [EC:2.7.10.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG8049 (Btk29A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dme01001]
    Dmel_CG8049 (Btk29A)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     Dmel_CG8049 (Btk29A)
Protein kinases [BR:dme01001]
 Non-receptor tyrosine kinases
  TEC family
   Dmel_CG8049 (Btk29A)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 PH BTK SH3_9 SH3_10 SH3_2
Other DBs
NCBI-GeneID: 34132
NCBI-ProteinID: NP_001097121
FlyBase: FBgn0003502
UniProt: P08630
LinkDB
Position
2L
AA seq 786 aa
MMGTKHRNSHVNGSIKSSSSLRSSSKSFQAKMDLMSERLYDVVKSGSMVKRAQNKKRFTP
VNYKHRWFELTKRTFSYFDVENVERRRERGRIHLKGVRLVEEATVSGEGGDPFAPDGYPF
QVGYCEISASANSHQLENGNGGGSGVGIEGQQSGRAVPQYTLYVIANSEKERSEWIRAIR
QVCEDSNTPKSYRYHPGLWSGKKWSCCKGLSRTTFGCRAAAHWREANNNPSNGSSPAQNS
TRSISPNSSTTNSQFSLQHNSSGSLGGGVGGGLGGGGSLGLGGGGGGGGSCTPTSLQPQS
SLTTFKQSPTLLNGNGTLLDANMPGGIPTPGTPNSKAKDNSHFVKLVVALYPFKAIEGGD
LSLEKNAEYEVIDDSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEWYVGDMSRQRA
ESLLKQGDKEGCFVVRKSSTKGLYTLSLHTKVPQSHVKHYHIKQNARCEYYLSEKHCCET
IPDLINYHRHNSGGLACRLKSSPCDRPVPPTAGLSHDKWEIHPMELMLMEELGSGQFGVV
RRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHRPIYIVTEY
MKHGSLLNYLRRHEKTLIGNMGLLLDMCIQVSKGMTYLERHNYIHRDLAARNCLVGSENV
VKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWEIFTCG
KMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYDVMKLCWSHGPEERPAFRVLMDQLALV
AQTLTD
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgatgggcactaagcatcgaaactcgcatgtcaatggcagcattaagtcatcatcatcg
ctgcgatcgagcagcaaatcctttcaagcaaaaatggatctgatgtccgaaaggctgtac
gatgtcgtgaaaagtggatcgatggtgaaaagggctcaaaacaagaagcgtttcaccccc
gtgaattacaaacatcgatggtttgagttgaccaagcgaactttcagctacttcgatgtg
gaaaatgtggagcggagacgcgaacgtggtcgcattcatttgaagggcgttcgcctggtg
gaggaggcgacggtcagtggcgagggcggcgatccctttgcaccggatggttatccgttc
caagtgggctactgtgagatctctgcgtcggccaattcgcatcagctggagaacggcaac
ggcggtggtagtggcgttggaatcgagggtcagcagagtggacgagcggtgccacagtac
acactctacgtgatcgccaacagcgaaaaggagcgcagcgagtggatccgcgccatccgc
caagtttgtgaggatagtaatactccaaaatcgtatcgctatcatccgggcttgtggtct
ggaaagaagtggagctgctgcaagggattatctcgaaccacatttggttgcagagcagcc
gcccattggcgtgaggccaacaataatccaagcaacggcagttctccagcccagaattca
acgcgcagcatcagtcccaacagctccacgaccaacagtcagtttagcttgcagcacaac
agctcggggagtctcggcggaggagtgggcggcggattgggaggcggaggcagccttggc
ctaggcggcggaggaggaggtggcggcagttgcacgcccacatcgctacagcctcagtcc
tcgctgacaactttcaagcagtccccaactctattgaacggcaacggaactctattggat
gccaatatgcctggcggtatacccactcccggaacaccaaattccaaagccaaggacaac
tcccactttgtcaagctggtggtggctctctatccattcaaggccatcgaaggcggcgat
ttatcgctggaaaagaatgccgaatacgaagtgatagatgactcacaagagcactggtgg
aaggtcaaagatgccttggggaatgtcggctatatacccagcaactatgtcaagccgaag
gctcttctgggcctggagcgctatgaatggtatgtgggcgacatgtcacgacagagagcc
gaatcgctgctgaagcaaggtgataaggagggctgctttgtggtcaggaagtcatcgacc
aagggtctctacacactatcgctgcataccaaagttccacagtcgcatgtgaagcactac
cacatcaagcaaaatgctcgctgcgagtattatttgagtgagaagcactgctgtgaaaca
attccggatctgattaactaccatcgccacaactctgggggtttggcttgccgactcaaa
tcctcgccctgcgatcgcccagttccaccgacggcgggattgtcccacgacaaatgggag
atccatccgatggaactgatgctgatggaggagcttggatcgggacagtttggtgttgtg
cggcgcggcaagtggcgtgggtctatcgacacagcggtcaagatgatgaaggaaggaacc
atgtccgaggacgatttcattgaggaggccaaggtgatgaccaagctgcagcatccaaat
cttgtgcagctatatggcgtctgctccaagcaccggcccatctacattgtgaccgagtac
atgaagcacggatccttgttgaattacttgcgacggcatgagaagaccctgattggtaat
atgggtctactccttgacatgtgcatacaggttagcaagggaatgacctacctggagcgc
cataactacattcaccgggatctggctgcccgcaactgtctcgtgggttccgagaatgtc
gttaaagtggccgactttggattggcccgatacgttctcgacgatcagtataccagctct
ggcggaaccaagttccccatcaagtgggccccgcccgaagtgctcaactacacgcgcttc
tcctctaagagcgatgtgtgggcatacggtgtgctgatgtgggagatcttcacttgcggc
aagatgccatacggtcgcctaaagaataccgaggttgtggagcgtgtgcagcgcggaatt
atcctagaaaaaccaaagtcgtgtgccaaggagatttatgatgtcatgaagttgtgctgg
tcacatggacccgaggagcgtcccgctttccgtgtgctcatggatcagctggctcttgtg
gcccaaacgctaaccgactaa

DBGET integrated database retrieval system