KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8285
Entry
Dmel_CG8285       CDS       T00030                                 

Gene name
boss
Definition
(RefSeq) bride of sevenless
  KO
K04623  bride of sevenless protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG8285 (boss)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:dme04030]
    Dmel_CG8285 (boss)
G protein-coupled receptors [BR:dme04030]
 Metabotropic glutamate receptor family
  Orphan GPRC5
   Dmel_CG8285 (boss)
SSDB
Motif
Pfam: 7tm_3
Other DBs
NCBI-GeneID: 43146
NCBI-ProteinID: NP_542440
FlyBase: FBgn0000206
UniProt: P22815 C4XVJ6
LinkDB
Position
3R
AA seq 896 aa
MKVMDALQSGRRKPLPVALLCILVTVFCVLECHGADLTSPTKKSAPLRITKPQPTSQQAK
PISITTRAPTTVASTTDDEVSSSVDGQLAPLISSTTEGPSSGTTASLVPEICLNGLQLTV
NSADEGTVIRKQEEFVKILEGDVVLSVLTKDPDSALFVINRVNQANLIMADFEIGIRAIS
IDNASLAENLLIQEVQFLQQCTTYSMGIFVDWELYKQLESVIKDLEYNIWPIPGTRAHLF
PKVAHLLHQMPWGEKIASVEIATETLEMYNEFMEAARQEHMCLMHFKSDDNVYIMFGNKL
ASHFKENGTLFSVPTDRTDDEFLADLPNRAFVLMENEIDLSTAVELDATPTALDEILIGK
SVLPSRVLSFAGSIIDLMNWLRGSLSKHCKRGEEHDLYVLESCFNFLNFIEDWRTSEYRQ
AHDTAEILSLLLMRKLGTAMNFQMYQKKVLTLDKITGESRTELREIASQNFVTNVTTYYH
YNRDNHTSLELKTKFGQVFNCQYSAGDNRRYPFLFDGESVMFWRIKMDTWVATGLTAAIL
GLIATLAILVFIVVRISLGDVFEGNPTTSILLLLSLILVFCSFVPYSIEYVGEQRNSHVT
FEDAQTLNTLCAVRVFIMTLVYCFVFSLLLCRAVMLASIGSEGGFLSHVNGYIQAVICAF
SVVAQVGMSVQLLVVMHVASETVSCENIYYGRWLWGLLAYDFALLCCVGALIPSIYRSQR
NYREGILIVIGSVLIMVIWVAWIALSLFGDEWRDAAIPLGLQASGWAVLVGILIPRTFLI
VRGIERSDIAQALPSLTSLAFAQNNQYSSEQSVYECVNPAMRHCSQDEVNHQSPSEIPTL
PLRGGGPRRQQFFANLRQANANINPQRPPPRPQQSPSRSSVSSLPPSPDHNKITRF
NT seq 2691 nt   +upstreamnt  +downstreamnt
atgaaggtcatggacgctttgcaatctggacggagaaagccattaccagtggctcttcta
tgcatcctagtcactgtgttctgcgtcttggagtgccatggagctgacctgacatcaccc
accaagaagtccgctccccttcgaataaccaaaccacagcccacaagtcagcaggccaag
cccatcagtattaccacaagggccccaacaacggtggcatcaaccaccgatgatgaagtc
tccagctccgtcgatggtcagctggccccgctcatctcatccacaaccgagggacccagc
agtggaacaactgccagcttagtgccggaaatatgtctcaatggtctgcagttgacggtc
aatagtgcggatgagggaacggttatacggaagcaggaggagtttgtcaagatactcgaa
ggagatgtggtgctcagtgtcttgaccaaggaccccgactccgcgttgttcgtaatcaat
cgtgtgaaccaggcgaatcttataatggcagactttgaaattggaattcgcgccatcagc
atcgacaacgccagcttggcagagaacttgcttattcaagaagttcagtttctgcagcag
tgcacgacgtactcgatgggcatattcgttgactgggagctgtacaaacaactggagtct
gttatcaaggacttggaatacaatatctggccaataccgggaacgcgggcgcacctcttt
cccaaagttgcgcacttgctgcatcaaatgccttggggcgaaaaaatcgcatccgtggaa
atagcaaccgaaacgctggagatgtacaatgaattcatggaagccgctcgccaggagcac
atgtgcctcatgcacttcaaaagtgacgataatgtttacataatgtttggcaataagcta
gctagtcacttcaaggaaaacggcactctgttttccgtgcccaccgatagaacggacgat
gaatttctggcagacttaccaaacagagcttttgtcctaatggaaaacgaaattgacctg
agcaccgccgttgaattggacgccacgcccaccgctttggacgagatcctgatcgggaag
agtgtgttaccatcgcgagtcctgagctttgccggctccataatcgacctgatgaactgg
ctgcgcggatccctgtccaagcactgtaagcgtggtgaggagcacgacttgtatgtgctg
gagagctgtttcaacttcctgaacttcatcgaggactggcgaacctcggagtaccgacaa
gcccatgatacggctgagatcctgtcgctgctgctgatgcgcaagttgggcaccgccatg
aactttcagatgtaccagaagaaagtgttgacgctggacaagatcacaggtgaatcgcgt
accgaactgcgcgagattgcgtcgcagaactttgtgaccaatgtgaccacgtactatcac
tataatcgggacaatcacaccagtttggagctgaagaccaagtttggtcaggtgttcaac
tgccagtacagtgctggtgacaataggagatatccattccttttcgatggtgaatccgtt
atgttctggcgcatcaagatggacacatgggtggcaactgggctgacggctgctatcctg
ggcctgattgccacgctcgccatcctggtgttcattgtggtgcgcatctcgttgggcgat
gtcttcgagggaaatccgaccacctcgattctccttctactctccctcatcttagtgttt
tgctcctttgtgccctattcgattgaatacgtgggtgagcagcgcaattcgcatgtgacc
ttcgaggatgcccagactctgaataccctgtgcgcggtgagggtgttcatcatgactctg
gtctactgttttgttttttccctgctcctctgtcgcgccgtgatgttggcttcaattggt
tccgaaggtggcttcctatcccatgtgaatggatatattcaggcagtgatttgcgccttt
agtgttgtggcccaagtgggcatgtccgtgcaacttctggtggtgatgcacgtcgcctcg
gagactgtgtcctgtgagaatatttactatggtcgatggttgtggggactgttggcctac
gactttgctctactgtgctgtgtgggcgccttgataccctctatatacagatcccaacga
aactatcgcgagggaatactcattgtcattggatcggttttaattatggtaatttgggtg
gcctggatagcgctatccttattcggggacgagtggagggatgcggccattccattggga
ttgcaggcctctggttgggcggtactggtgggcattctgataccacgcaccttcctcatc
gtaaggggtatcgagcggtcggatattgcccaagctctgccttcactcacttcgctggct
tttgcccagaacaatcaatactcctcggaacagagtgtttacgagtgcgtgaatcccgcc
atgcgccattgttcccaggatgaggtgaaccaccagtcgcctagtgagattcccacgtta
ccccttcgaggaggtggcccacgtcgccagcagttctttgccaatctccgccaggccaat
gccaacattaatccacaacgtcctccacctcgaccccagcagagtccctcccgatcctcg
gtgtcctcgctgccgccctcgcccgatcacaacaagatcacccggttttag

DBGET integrated database retrieval system