KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8694Help
Entry
Dmel_CG8694       CDS       T00030                                 

Gene name
Mal-A2
Definition
(RefSeq) maltase A2
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00052  Galactose metabolism
dme00500  Starch and sucrose metabolism
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Dmel_CG8694 (Mal-A2)
   00500 Starch and sucrose metabolism
    Dmel_CG8694 (Mal-A2)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Dmel_CG8694 (Mal-A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 35825
NCBI-ProteinID: NP_476625
FlyBase: FBgn0002569
UniProt: P07191
LinkDB All DBs
Position
2R
AA seq 567 aa AA seqDB search
MPKWAHLGLAALLLISTTQEGTADIDWWENASLYQIYPRSFQDSDGDGIGDLKGITSRLG
YLKEIGITATWLSPIFTSPMSDFGYDISNFYDIDPIFGTLEDFDDLIVEAKSLGVKIILD
FVPNHSSDENVWFEKSVNREDGYDDFYVWDDGKLNEETGARDPPSNWVSVFSGPMWTWNE
KRQQYFLHQFQVKQPDLNFTNPMVREHMLDVLKFWLDRGVDGFRIDAVPHIYEHRNADGS
YPDEPVSGWGSDPNAYDYHDHIYTKDQPATVDLMYEWREFLDNYRAQNGGDSRVLLAEAY
SSVETLSAYFGNSTHQGTQLPMNFQLMYLSGYSTAKDVVGSIDYWMNTMWKEHQTANWVV
GNHDTNRVADRMGAHKVDLLNVIVNALPGASVTYYGEEIGMSNVDVECTGDSCEDRDGER
TPMQWTAGKNADFSDGESTWLPLSPEYQRYNVQTERGVSRSSLNIFKGLQELKSSSAFLA
FKEDGGFSYEAVTEQVLQIIRTNKISEEYRILVNMGNGMEILDGLAPKTYEYVLATAYST
HYSGQKADLSQRIILMPYEAVVLRWLA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagtgggcacatctcgggctagcagctctccttctaatttccaccacccaggag
ggtactgcagatatcgattggtgggagaacgcctcgctgtaccagatatatccgcgctcc
ttccaggacagcgatggcgatggcatcggggacctgaaaggcattacttcgagattgggc
tacctcaaggaaataggcatcacggccacctggctgtcgcccatttttacctcgcccatg
tcggatttcggctacgacatctctaacttttatgacatcgatccgattttcggcactctc
gaggatttcgatgaccttatagtggaggccaagtcgctgggcgttaagatcattctcgac
tttgtacccaaccactcgagtgacgagaacgtgtggtttgaaaagtccgtgaatcgcgaa
gatggctacgacgacttctacgtgtgggacgatggaaaactgaatgaggaaactggtgca
agagatcctccatctaattgggtcagtgtgttcagcggacccatgtggacgtggaacgag
aagcgccagcagtacttcctgcaccagtttcaggtgaagcagccggatctaaactttacc
aatccaatggtcagggagcacatgctggatgtcttgaagttttggctggaccgcggagtt
gatggatttcgtatcgatgcagttccacacatctacgagcaccgcaatgcagacggatcc
tatccggatgaaccggttagcggttggggcagtgaccccaacgcctacgactaccatgat
cacatctacaccaaggaccagccggccacggtggatctcatgtacgaatggcgtgagttt
ttggacaactatcgggcgcagaatggaggcgattcacgggttctcctggccgaggcctat
tcttccgtggagacactaagtgcttacttcggaaacagcacccatcagggtacccagctg
cccatgaacttccagttgatgtatctcagtggatactccaccgccaaggatgttgtggga
tctatcgactactggatgaataccatgtggaaggagcaccagacggccaattgggttgtt
ggtaatcacgataccaaccgagtggccgatcgtatgggagctcacaaagtggatctacta
aatgtgattgtaaacgccctgccaggtgcttcggtaacctactacggcgaggaaattggc
atgtccaacgtggacgtggagtgcaccggcgactcttgcgaggatcgcgatggggagcgc
acgcccatgcagtggacggctggaaagaatgccgacttctctgatggggagtccacctgg
ctgcctctaagtcccgaatatcaacggtacaatgtgcagactgaacgcggtgtttccaga
tcttccctgaacatctttaagggtcttcaagaacttaagagcagttccgcctttcttgcg
ttcaaagaggatggaggtttctcctacgaggcggtgacggaacaggttctacagatcatt
cgcacaaacaagatcagcgaggagtatcgaatcctggtcaacatgggcaacggtatggaa
atcctcgatgggctcgcccccaaaacctacgagtatgtgctggccactgcctactccaca
cactattcggggcaaaaagcagatctgtcacagagaatcattctcatgccctacgaagca
gtcgttctacgctggttggcttaa

DBGET integrated database retrieval system