KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9577
Entry
Dmel_CG9577       CDS       T00030                                 
Symbol
CG9577
Name
(RefSeq) uncharacterized protein
  KO
K12663  Delta3,5-Delta2,4-dienoyl-CoA isomerase [EC:5.3.3.21]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dmel_CG9577 (CG9577)
Enzymes [BR:dme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.21  Delta3,5-Delta2,4-dienoyl-CoA isomerase
     Dmel_CG9577 (CG9577)
SSDB
Motif
Pfam: ECH_1 ECH_2 RNase_P_p30
Other DBs
NCBI-GeneID: 33016
NCBI-ProteinID: NP_608375
FlyBase: FBgn0031092
UniProt: Q9W5W8
LinkDB
Position
X:20166673..20168080
AA seq 312 aa
MSLSRLNTLMKLTPKPTAIGSLKMQRNLSALPESGPTGSFKTLAVSSPKPFVFHVELHRP
SKFNAISKQMWLEIKECFDGLATNPDCRAIVLSASGKHFTAGIDLNDMINVGQTLAETDD
YARKGVSMERMIKVYQDSISSLEHCPKPVITAVHKACIGAGVDLITAADIRYCTEDAFFQ
VKEVDIGMAADVGTLQRLPKAVGSQSLARELCFTGRKFEAAEAHSSGLVSRLFPDKDSLL
TGALAVAELIASKSPVAVKTTKESLVYSLEHTNQEGLDHILLLNKLNLLSEDFAQAVAAQ
LTKDDKPVFAKL
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtcgctctcccgcctgaacactctgatgaaactaacgcccaagcccacggccatcgga
tcccttaagatgcagagaaacctttccgccctcccggaatccggacccaccggctctttc
aagacgctggccgtcagttcgcccaagccgttcgtctttcatgtggagctccatcggccc
agcaagttcaacgccataagcaagcagatgtggctggagatcaaggagtgcttcgacgga
ctggccactaatcccgactgccgggctatcgttttgtccgcctccggaaagcacttcacc
gccggcatcgacctcaacgacatgataaacgtgggccaaacgctggccgagaccgatgac
tacgcccgcaagggcgtctccatggagcgaatgatcaaggtgtaccaggactcaatcagc
agcctggagcactgccccaagccggtcatcacggcggtgcacaaggcgtgcatcggcgcc
ggcgtggacctgattaccgccgccgacattcgctactgcaccgaggacgcctttttccag
gtcaaggaggtggacatcggcatggccgccgacgtgggcaccctgcagcgtctgcccaag
gcagtgggcagtcagtccctcgcccgcgagctgtgcttcactgggcgcaaattcgaggcc
gccgaggcccactcctcgggcctggtgagtcgcctcttcccagacaaggattccctgctg
accggagccctggccgtggccgagctcatcgctagcaagagtcccgtcgccgtaaagaca
accaaggagagcctcgtgtactccctggagcacaccaatcaagagggcttggatcacatt
ctcctgctgaacaagctcaacctgctgtcggaggacttcgcccaggctgtggccgcccag
ttgacgaaggacgataagccagtgttcgccaagctgtga

DBGET integrated database retrieval system