KEGG   Drosophila miranda: 108159850
Entry
108159850         CDS       T06132                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein isoform X3
  KO
K20017  Bcl-2 family protein
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108159850
   04215 Apoptosis - multiple species
    108159850
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 108159850
NCBI-ProteinID: XP_017148931
LinkDB
Position
3
AA seq 296 aa
MPGTSYPTNNDNFSHGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEVGQRETTRRRL
SNVSDVVTRKLSYTIGWKAAQIPAQDIITQGRCLCGHYIKRRLRRSGLFNKKLGLQRIRS
ILGSTSMGIVRDVFPAVQVLGDELERMHPRAYNGVARQICRNPGGEFHTPDAVSLLLGAV
GRDLFRADITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINENG
GWSGINTHVLPTTNSLNPLEWTTLVIGVVFGLILLFMFLRFIVSTIIPKIYQRFTN
NT seq 891 nt   +upstreamnt  +downstreamnt
atgcccggcacctcgtatcccacgaataacgataatttcagtcacggcttccccatggcc
accacacagagcgaacgcctgctgcaggcccagaatcggcgcaagttcagcttcccggcc
acgctccactccgcctcgctgctggaggtggggcaacgcgagacgacccggcggcgcctc
agcaatgtcagcgacgttgtcaccaggaaactctcctacaccattggctggaaggcggca
cagattcccgcccaggacatcataacgcagggccgctgtctgtgcgggcactacatcaag
cgacgcctgagacgatctggtttgttcaacaagaagttgggcctgcagcgaatacggagt
atcctgggctccacctccatgggcattgtgcgggatgtctttccagcggttcaggtgctt
ggcgacgaactggaacggatgcatccacgtgcctataacggcgtcgctcgtcagatttgt
cgcaatcctgggggcgagttccacacacccgatgctgtcagcctgctcctaggggcggtg
ggtcgcgatcttttccgggcggacatcacctggagcaaggtgatctcgctgtttgccatt
gccggcggcctgtcggtggactgtgtgcggcaggggcatcccgagtacctgcccaagctg
atggagagcgtctcggaggtgattgaggatgagctggtgccctggatcaatgagaacggt
ggctggagcggcatcaatacccatgttctgcccacgaccaacagcttgaatccgctcgag
tggacgacgctggtgataggtgtggtttttggcctaattctgctttttatgttcttacgt
tttatagtaagcacgataataccgaaaatatatcaacgatttacgaactga

KEGG   Drosophila miranda: 117193850
Entry
117193850         CDS       T06132                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein-like
  KO
K20017  Bcl-2 family protein
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    117193850
   04215 Apoptosis - multiple species
    117193850
SSDB
Motif
Pfam: Bcl-2 DUF5693
Other DBs
NCBI-GeneID: 117193850
NCBI-ProteinID: XP_033254441
LinkDB
Position
Y
AA seq 152 aa
MRSTSSDKVTKFGIRTITCPGEFHTPDAVSLLLGAVGRDLFRADITWSKVISLFAIAGGL
SVYCVRQGHPEYLPKLMESVSEVIEDELVPWINENGGWSGINTHVLPTTNSLNPLEWTTL
VIGVVFGLILLFMFLRFIVSTIIPKIYQRFTN
NT seq 459 nt   +upstreamnt  +downstreamnt
atgcgatccacttccagcgataaagtaaccaaatttggtatccgcacgatcacctgcccg
ggtgagttccacacacccgatgctgtcagcctgctcctaggggcggtgggtcgggatctg
ttccgggcggacatcacctggagcaaggtgatctcgctgtttgccattgccggcggcctg
tcggtgtactgtgtgcggcaggggcatcccgagtacctgcccaagctgatggagagcgtc
tcggaggtgattgaggatgagctggtgccctggatcaatgagaacggtggctggagcggc
atcaatacccatgttctgcccacgaccaacagcttgaatccgctcgagtggacgacgctg
gtgataggtgtggtttttggcctaattctgctttttatgttcttacgttttatagtaagc
acgataataccgaaaatatatcaacgatttacgaactga

DBGET integrated database retrieval system