KEGG   Drosophila miranda: 108165504
Entry
108165504         CDS       T06132                                 

Definition
(RefSeq) cell death protein rpr
  KO
K20014  cell death protein rpr
Organism
dmn  Drosophila miranda
Pathway
dmn04214  Apoptosis - fly
dmn04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dmn00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    108165504
   04215 Apoptosis - multiple species
    108165504
SSDB
Other DBs
NCBI-GeneID: 108165504
NCBI-ProteinID: XP_017157051
LinkDB
Position
XR
AA seq 72 aa
MAVAFYIPDQATLLRKAAQQEQELLRLRDSQWRFLATVVLETLRQFMDSAASQCLPRSGG
GRKCGKYRKPSQ
NT seq 219 nt   +upstreamnt  +downstreamnt
atggcagtggccttctacatacccgaccaggcgactctgctgcgcaaggcggcgcaacag
gagcaggagctgctgcgcctacgcgactcccagtggcgcttcctggccaccgtcgtcctc
gagaccctacgccagttcatggacagcgcggccagccagtgcctgccacggtccgggggc
ggacgcaagtgcggcaagtaccgcaagccctcccagtaa

DBGET integrated database retrieval system