KEGG   Drosophila mojavensis: Dmoj_GI11618
Entry
Dmoj_GI11618      CDS       T01062                                 

Definition
(RefSeq) uncharacterized protein
  KO
K13647  procollagen-lysine,2-oxoglutarate 5-dioxygenase, invertebrate [EC:1.14.11.4]
Organism
dmo  Drosophila mojavensis
Pathway
dmo00310  Lysine degradation
dmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Dmoj_GI11618
Enzymes [BR:dmo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.4  procollagen-lysine 5-dioxygenase
     Dmoj_GI11618
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 Glycos_transf_2
Other DBs
NCBI-GeneID: 6583116
NCBI-ProteinID: XP_002008794
FlyBase: FBgn0134378
UniProt: B4L188
LinkDB
Position
Unknown
AA seq 744 aa
MEKHINCALLFLASLLLFLQGASASAANAADVVAPAEVVAAAPAQPNLNDKIKVFTVATE
QTDGYRRYIRSAQVYDIEVTTLGLGEEWQGGDMKGLGGGYKINLLRKAVEELKDAEDTII
LFTDSYDVVFTAPLTEILEKFKESGAKVLFSAEKYCWPDKSLADSYPAVGAKESRYLNSG
AFIGYAPQVVELLKEEIEDTGDDQLYYTKIFLDEAKRAKLNIKLDTQSRLFQSLNGAQND
VKLEVDLDSNQGVLQNIDFLTTPAIIHGNGPSKINLNAYANYLAKTFSGVCTFCQEYPLE
LNEQELPIITLAVMVNQPVPFLDMFLAGIEKLNYPKKSMHLFMYSNAELHDELVQSYVTK
HGKSYASVKYILSTDGLTESQGRQLALDKAKQKHSDYIFYVDGDAHIEDSEVLRELLRMN
KQFVAPVFSKYHELWSNFWGALSETGYYARSHDYVDIVKRNLIGMFNVPHVTTIYLIKKS
AFDAVKFEHKELDPDMAMSDSLRDAGVFMYVSNERYFGHLINADNFNTTVARPDFYTLFS
NRYDWTLKYIHPNYSTQLNESVVIPQPCPDVYWFQIVTDAFCDDLVAIMEAYGKWSDGSN
SDTRLEGGYEAVPTRDIHMRQVGLDALYLKFLQMFVRPLQERVFMGYFHDPPRSLMNFMV
RYKPDEQPSLRPHHDSSTYTINIAMNRVGIDYEGGGCRFLRYNCSVTETKKGWMLMHPGR
LTHFHEGLLVTKGTRYIMISFIDP
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggaaaagcatataaattgcgcattgttgtttctggcgtcgctcttgttgtttttgcaa
ggagccagcgccagtgcagcgaacgccgccgatgttgttgcacccgccgaagttgttgca
gctgcaccagctcaaccaaacttaaatgataaaataaaagtcttcaccgttgccacggaa
caaactgatggatatcgccgttatatacgctccgcccaagtttacgacattgaggtgacc
acccttggcctgggcgaggaatggcaaggaggtgacatgaagggccttggcggcggctac
aaaatcaatttgctgcgtaaagctgtcgaggagctcaaggatgctgaggataccatcatc
ctatttacggacagctatgatgtcgtcttcacagctccgcttacggagatcttggaaaag
ttcaaggaatccggtgccaaggtgctgttctcggcagagaaatattgctggcccgacaag
agtctcgcggatagttatcctgcggtgggggccaaggagtcacgttatttgaactcgggc
gccttcatcggctacgcgccacaggtggttgagctgctgaaggaggaaatcgaggatacg
ggcgatgatcagttgtattacacgaaaattttcctggatgaggcaaagcgcgccaagctg
aacatcaaactggatacgcagtcgcgtctgttccaaagcctgaatggtgcccaaaacgat
gtaaagctagaggtggatctggactccaatcaaggcgtgttgcaaaatatcgatttcctg
accacgcccgccattatccatggcaatgggccgagcaaaatcaacctgaacgcctatgcc
aactatctggccaagacttttagtggcgtctgcaccttctgccaggaatatccgctcgag
ttgaatgagcaagaactgcctatcattactctagctgtaatggtgaatcaacctgtgcct
ttccttgatatgttccttgctggcatcgagaagctcaactatcctaagaagtcgatgcac
ctcttcatgtacagcaacgcagagctacacgatgagctcgtgcagtcctatgtgactaag
catggcaagagctatgccagcgtcaagtatatcctatccacggatggattaactgaaagt
cagggcaggcaattggcacttgacaaagcaaagcagaagcacagcgactacattttctac
gtggacggcgatgcacacatcgaggacagcgaggtgctgcgcgagctgctcagaatgaac
aaacaatttgtggcgccggtgttctccaaatatcacgagctgtggagcaacttttggggc
gcgctctctgagacgggctactatgcacgctcccatgactacgtggacattgtcaagcgg
aatctgatcggcatgttcaatgtgccacatgtgacgacaatttatctgatcaagaagagc
gccttcgatgcagtcaaattcgagcacaaggaactcgaccctgatatggccatgtctgat
tctctaagagatgcgggcgtcttcatgtacgtcagcaatgagcgttatttcgggcatctg
atcaatgcggataacttcaatacgaccgtagctcgtcccgatttctataccctgttcagc
aatcgctatgattggaccttgaagtacatccatcccaactattcgacgcagctgaacgag
agcgtggtcattccacagccctgccccgacgtctattggttccagattgtgaccgacgcc
ttctgcgacgatttggtggctattatggaagcgtatggcaagtggtccgatggcagcaat
agcgatacgcgattggagggtggctacgaggcggtgcccacgcgtgacattcacatgcga
caagtgggactcgatgcgctgtatctgaagtttttgcaaatgtttgtgcgtccgctgcag
gagcgtgtctttatgggctatttccatgatcctccgcggtctctgatgaatttcatggtg
cgctacaagcccgatgagcagccctctctgcgtccacatcacgactcctcgacctacaca
atcaacatcgcaatgaatcgggtgggcattgattacgaaggcggcggctgtcgctttttg
agatacaattgctctgtgacggagacgaagaagggctggatgctaatgcatccgggtcgt
ttgactcacttccatgagggcctgctggtgaccaagggcacacgctatatcatgatttcg
tttatcgatccgtag

DBGET integrated database retrieval system